SitesBLAST
Comparing GFF3919 FitnessBrowser__Phaeo:GFF3919 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1h5tA Thymidylyltransferase complexed with thymidylyldiphosphate-glucose (see paper)
65% identity, 96% coverage: 10:294/296 of query aligns to 3:287/290 of 1h5tA
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: L8 (= L15), G10 (= G17), Q82 (= Q89), P85 (= P92), G87 (= G94), L108 (= L115), D110 (= D117), Y145 (= Y152), G146 (= G153), E161 (= E168), K162 (= K169), V172 (= V179), R194 (= R201)
- binding thymidine-5'-diphosphate: Y114 (≠ F121), G115 (= G122), H116 (= H123), D117 (≠ G124), R219 (= R226), G220 (= G227), V250 (≠ T257), S251 (≠ G258)
1h5rA Thymidylyltransferase complexed with thimidine and glucose-1-phospate (see paper)
65% identity, 96% coverage: 10:294/296 of query aligns to 3:287/290 of 1h5rA
- binding 1-O-phosphono-alpha-D-glucopyranose: L88 (= L95), Y145 (= Y152), G146 (= G153), E161 (= E168), K162 (= K169), V172 (= V179)
- binding thymidine: L8 (= L15), G10 (= G17), G11 (= G18), Q82 (= Q89), P85 (= P92), G87 (= G94), L88 (= L95), D110 (= D117), Y114 (≠ F121), G115 (= G122), V250 (≠ T257), S251 (≠ G258), E255 (= E262), I256 (= I263)
1h5sB Thymidylyltransferase complexed with tmp (see paper)
65% identity, 96% coverage: 10:293/296 of query aligns to 4:287/291 of 1h5sB
- binding thymidine-5'-phosphate: L9 (= L15), G11 (= G17), G12 (= G18), Q83 (= Q89), P86 (= P92), D87 (= D93), G88 (= G94), D111 (= D117), Y115 (≠ F121), G116 (= G122), H117 (= H123), D118 (≠ G124), G219 (= G225), R220 (= R226), G221 (= G227), S252 (≠ G258), E256 (= E262), I257 (= I263), R260 (≠ E266)
P26393 Glucose-1-phosphate thymidylyltransferase; dTDP-glucose pyrophosphorylase; Ep; dTDP-glucose synthase; EC 2.7.7.24 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
63% identity, 97% coverage: 10:296/296 of query aligns to 4:290/292 of P26393
- T201 (= T207) mutation to A: Two-fold increase in the conversion of 2-acetamido-2-deoxy-alpha-D-glucopyranosyl phosphate.
- W224 (= W230) mutation to H: Is able to convert both 6-acetamido-6-deoxy-alpha-D-glucopyranosyl phosphate and alpha-D-glucopyranuronic acid 1-(dihydrogen phosphate), which are not accepted by the wild-type.
5ifyA Crystal structure of glucose-1-phosphate thymidylyltransferase from burkholderia vietnamiensis in complex with 2 -deoxyuridine-5'- monophosphate and 2'-deoxy-thymidine-b-l-rhamnose
65% identity, 97% coverage: 9:296/296 of query aligns to 1:288/293 of 5ifyA
- binding 2'-deoxy-thymidine-beta-l-rhamnose: L7 (= L15), G9 (= G17), Q81 (= Q89), P84 (= P92), G86 (= G94), L87 (= L95), D109 (= D117), Y144 (= Y152), G145 (= G153), E160 (= E168), K161 (= K169), V171 (= V179), Y175 (= Y183), R193 (= R201)
- binding 2'-deoxyuridine 5'-monophosphate: Y113 (≠ F121), G114 (= G122), H115 (= H123), D116 (≠ G124), G217 (= G225), R218 (= R226), G219 (= G227), E254 (= E262), I255 (= I263)
6n0uA Crystal structure of a glucose-1-phosphate thymidylyltransferase from burkholderia phymatum bound to 2'-deoxy-thymidine-b-l-rhamnose
64% identity, 97% coverage: 9:295/296 of query aligns to 3:289/295 of 6n0uA
- binding 2'-deoxy-thymidine-beta-l-rhamnose: L9 (= L15), G11 (= G17), G12 (= G18), Q83 (= Q89), P86 (= P92), G88 (= G94), L89 (= L95), L109 (= L115), D111 (= D117), Y146 (= Y152), G147 (= G153), E162 (= E168), K163 (= K169), V173 (= V179), G175 (= G181), Y177 (= Y183), R195 (= R201)
4b2xB Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
63% identity, 99% coverage: 4:296/296 of query aligns to 6:298/302 of 4b2xB
1iinA Thymidylyltransferase complexed with udp-glucose (see paper)
63% identity, 97% coverage: 10:295/296 of query aligns to 4:289/289 of 1iinA
- binding uridine-5'-diphosphate-glucose: L9 (= L15), G11 (= G17), G12 (= G18), R16 (= R22), Q83 (= Q89), P86 (= P92), D87 (= D93), G88 (= G94), L89 (= L95), L109 (= L115), D111 (= D117), Y146 (= Y152), G147 (= G153), E162 (= E168), K163 (= K169), V173 (= V179), R195 (= R201), W224 (= W230)
1iimA Thymidylyltransferase complexed with ttp (see paper)
63% identity, 97% coverage: 10:295/296 of query aligns to 4:289/289 of 1iimA
- binding thymidine-5'-triphosphate: L9 (= L15), G11 (= G17), G12 (= G18), S13 (= S19), G14 (= G20), T15 (= T21), R16 (= R22), Q27 (= Q33), Q83 (= Q89), P86 (= P92), G88 (= G94), L89 (= L95), D111 (= D117), Y115 (≠ F121), G116 (= G122), H117 (= H123), P120 (= P126), G219 (= G225), R220 (= R226), G221 (= G227), S252 (≠ G258), E256 (= E262), I257 (= I263)
5fuhA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
64% identity, 97% coverage: 10:296/296 of query aligns to 8:294/298 of 5fuhA
- binding N-[6-amino-1-(3-bromobenzyl)-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl]-N-methylbenzenesulfonamide: T47 (≠ V49), L50 (= L52), Y118 (≠ F120), G120 (= G122), F123 (≠ L125), A256 (≠ G258), R264 (≠ E266), Q265 (≠ A267)
4b4bA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
64% identity, 97% coverage: 10:296/296 of query aligns to 8:294/298 of 4b4bA
3pkpB Q83s variant of s. Enterica rmla with datp (see paper)
63% identity, 97% coverage: 10:296/296 of query aligns to 3:289/289 of 3pkpB
- binding 2'-deoxyadenosine 5'-triphosphate: G10 (= G17), G11 (= G18), S12 (= S19), G13 (= G20), T14 (= T21), R15 (= R22), K25 (= K32), Q26 (= Q33), S82 (≠ Q89), P85 (= P92), G109 (= G116), D110 (= D117)
- binding magnesium ion: D110 (= D117), D225 (= D232)
5fu8A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
64% identity, 97% coverage: 10:296/296 of query aligns to 7:293/297 of 5fu8A
- binding N-(6-amino-1-(4-bromo-3-methylbenzyl)-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)-N-methylbenzenesulfonamide: S45 (= S48), L49 (= L52), Y117 (≠ F120), Y118 (≠ F121), G119 (= G122), H123 (≠ P126), V254 (≠ T257), E259 (= E262), R263 (≠ E266), Q264 (≠ A267)
4b2wA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
64% identity, 97% coverage: 10:296/296 of query aligns to 7:293/297 of 4b2wA
4arwA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
64% identity, 97% coverage: 10:296/296 of query aligns to 4:290/294 of 4arwA
- binding n-(6-amino-1-butyl-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)-n-methyl-benzenesulfonamide: S42 (= S48), L46 (= L52), Y114 (≠ F120), Y115 (≠ F121), G116 (= G122), V251 (≠ T257), A252 (≠ G258), E256 (= E262)
3pkpA Q83s variant of s. Enterica rmla with datp (see paper)
63% identity, 97% coverage: 10:296/296 of query aligns to 4:290/290 of 3pkpA
- binding 2'-deoxyadenosine 5'-triphosphate: G11 (= G17), G12 (= G18), S13 (= S19), G14 (= G20), T15 (= T21), R16 (= R22), K26 (= K32), Q27 (= Q33), S83 (≠ Q89), P86 (= P92), G110 (= G116), D111 (= D117)
5fyeA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
64% identity, 97% coverage: 10:296/296 of query aligns to 6:292/296 of 5fyeA
- binding N-(6-Amino-1-(3-fluorobenzyl)-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)-N-methylbenzenesulfonamide: S44 (= S48), L48 (= L52), Y116 (≠ F120), G118 (= G122), V253 (≠ T257), A254 (≠ G258), E258 (= E262), R262 (≠ E266)
5fu0A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
64% identity, 97% coverage: 10:296/296 of query aligns to 6:292/296 of 5fu0A
- binding n-(6-amino-1-(3-methylbenzyl)-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)-n-methylbenzenesulfonamide: S44 (= S48), L48 (= L52), Y116 (≠ F120), Y117 (≠ F121), G118 (= G122), H122 (≠ P126), V253 (≠ T257), A254 (≠ G258), E258 (= E262), Q263 (≠ A267)
5ftvA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
64% identity, 97% coverage: 10:296/296 of query aligns to 6:292/296 of 5ftvA
- binding n-(6-amino-1-(4-bromobenzyl)-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)-n-methylbenzenesulfonamide: S44 (= S48), L48 (= L52), Y116 (≠ F120), Y117 (≠ F121), G118 (= G122), F121 (≠ L125), V253 (≠ T257), A254 (≠ G258), E258 (= E262), R262 (≠ E266), Q263 (≠ A267)
5ftsA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
64% identity, 97% coverage: 10:296/296 of query aligns to 6:292/296 of 5ftsA
- binding N-(6-Amino-1-(2-bromobenzyl)-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-5-yl)-N-methylbenzenesulfonamide: S44 (= S48), L48 (= L52), Y116 (≠ F120), G118 (= G122), H122 (≠ P126), V253 (≠ T257), A254 (≠ G258), E258 (= E262), I259 (= I263)
Query Sequence
>GFF3919 FitnessBrowser__Phaeo:GFF3919
MTTGTSGAGRKGIILAGGSGTRLYPITMAVSKQLLPLYDKPMIYYPLSVLMLAGIREICV
ITTPQDQDQFTRLLGDGSQWGISLTYVEQPSPDGLAQAFVLAEDFLDGAPSALVLGDNVF
FGHGLPKLLAAADAQTSGGTVFGYHVADPERYGVVDFDAEGRAREIIEKPAVPPSNYAVT
GLYFLDGSAPERARQVTPSPRGELEITDLLQMYLDEEALRVETMGRGYAWLDTGTHGSLL
DAGNFVRTLQERQGLQTGCPEEIAHEAGWIDAAQLRTRAEMFAKNAYGAYLERLLN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory