SitesBLAST
Comparing GFF3921 FitnessBrowser__Phaeo:GFF3921 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P27830 dTDP-glucose 4,6-dehydratase 2; EC 4.2.1.46 from Escherichia coli (strain K12) (see 2 papers)
64% identity, 99% coverage: 2:349/350 of query aligns to 3:354/355 of P27830
- FI 12:13 (= FI 11:12) binding
- DKLT 33:36 (≠ DALT 31:34) binding
- DI 59:60 (= DI 57:58) binding
- T100 (= T98) binding
- D135 (= D131) active site, Proton donor
- E136 (= E132) active site, Proton acceptor
- Y160 (= Y157) active site, Proton acceptor
- YSASK 160:164 (= YSASK 157:161) binding
- N190 (= N187) binding
1kewA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from salmonella enterica serovar typhimurium with thymidine diphosphate bound (see paper)
61% identity, 97% coverage: 1:338/350 of query aligns to 1:346/361 of 1kewA
- active site: T133 (= T130), D134 (= D131), E135 (= E132), L152 (vs. gap), L154 (≠ M144), F155 (= F145), T158 (≠ E148), Y167 (= Y157), K171 (= K161)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (= I12), D32 (= D31), K33 (≠ A32), L34 (= L33), T35 (= T34), A37 (= A36), G38 (≠ A37), D58 (= D57), I59 (= I58), L80 (= L79), A81 (= A80), A82 (= A81), S84 (= S83), T99 (= T98), I131 (= I128), S132 (= S129), T133 (= T130), Y167 (= Y157), K171 (= K161), C194 (= C184), N196 (= N186), N197 (= N187)
- binding thymidine-5'-diphosphate: E135 (= E132), N196 (= N186), K206 (= K196), L207 (= L197), P222 (= P212), Y224 (= Y214), R231 (= R221), N266 (= N256), R297 (= R289), H300 (= H292)
Sites not aligning to the query:
1keuA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from salmonella enterica serovar typhimurium with dtdp-d-glucose bound (see paper)
61% identity, 97% coverage: 1:338/350 of query aligns to 1:346/361 of 1keuA
- active site: T133 (= T130), D134 (= D131), E135 (= E132), L152 (vs. gap), L154 (≠ M144), F155 (= F145), T158 (≠ E148), Y167 (= Y157), K171 (= K161)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S84 (= S83), T133 (= T130), D134 (= D131), E135 (= E132), Y167 (= Y157), N196 (= N186), K206 (= K196), L207 (= L197), P222 (= P212), Y224 (= Y214), R231 (= R221), N266 (= N256), R297 (= R289), H300 (= H292)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (= I12), D32 (= D31), K33 (≠ A32), L34 (= L33), T35 (= T34), G38 (≠ A37), D58 (= D57), L80 (= L79), A81 (= A80), A82 (= A81), S84 (= S83), T99 (= T98), S132 (= S129), T133 (= T130), Y167 (= Y157), K171 (= K161), C194 (= C184), N196 (= N186), N197 (= N187)
Sites not aligning to the query:
P26391 dTDP-glucose 4,6-dehydratase; EC 4.2.1.46 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
61% identity, 97% coverage: 1:338/350 of query aligns to 1:346/361 of P26391
Sites not aligning to the query:
1bxkB Dtdp-glucose 4,6-dehydratase from e. Coli
62% identity, 98% coverage: 2:345/350 of query aligns to 3:344/344 of 1bxkB
- active site: S125 (≠ E121), T134 (= T130), D135 (= D131), E136 (= E132), S158 (= S155), Y160 (= Y157), S161 (= S158), K164 (= K161)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (= I12), D33 (= D31), K34 (≠ A32), L35 (= L33), T36 (= T34), A38 (= A36), G39 (≠ A37), D59 (= D57), I60 (= I58), L81 (= L79), A83 (= A81), T100 (= T98), I132 (= I128), S133 (= S129), T134 (= T130), K164 (= K161), C187 (= C184)
8du1A Crystal structure of NAD bound dtdp-glucose 4,6-dehydratase from elizabethkingia anophelis
55% identity, 97% coverage: 3:340/350 of query aligns to 6:351/361 of 8du1A
- binding nicotinamide-adenine-dinucleotide: G10 (= G7), G13 (= G10), F14 (= F11), I15 (= I12), D36 (= D31), A37 (= A32), L38 (= L33), T39 (= T34), G42 (≠ A37), D62 (= D57), I63 (= I58), L84 (= L79), A85 (= A80), A86 (= A81), T103 (= T98), S143 (= S129), T144 (= T130), Y169 (= Y157), K173 (= K161), C196 (= C184)
6bi4C 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6- dehydratase (rfbb) from bacillus anthracis str. Ames in complex with NAD. (see paper)
47% identity, 96% coverage: 1:337/350 of query aligns to 2:311/311 of 6bi4C
- active site: T117 (= T130), D118 (= D131), E119 (= E132), Y142 (= Y157), K146 (= K161)
- binding beta-D-fructofuranose: Q62 (≠ R59), N63 (≠ D60), G64 (≠ R61), E65 (≠ A62)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (= I12), D34 (= D31), A35 (= A32), L36 (= L33), T37 (= T34), S39 (≠ A36), G40 (≠ A37), E60 (≠ D57), I61 (= I58), Q62 (≠ R59), F82 (≠ L79), A83 (= A80), A84 (= A81), T92 (= T98), V115 (≠ I128), T117 (= T130), Y142 (= Y157), K146 (= K161), C169 (= C184), S170 (= S185)
6bi4B 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6- dehydratase (rfbb) from bacillus anthracis str. Ames in complex with NAD. (see paper)
47% identity, 96% coverage: 1:337/350 of query aligns to 2:310/310 of 6bi4B
- active site: T117 (= T130), D118 (= D131), E119 (= E132), Y142 (= Y157), K146 (= K161)
- binding alpha-D-glucopyranose: Q62 (≠ R59), N63 (≠ D60)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (= I12), D34 (= D31), A35 (= A32), L36 (= L33), T37 (= T34), S39 (≠ A36), G40 (≠ A37), E60 (≠ D57), F82 (≠ L79), A83 (= A80), A84 (= A81), T92 (= T98), S116 (= S129), T117 (= T130), Y142 (= Y157), K146 (= K161), C169 (= C184)
1ketA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with thymidine diphosphate bound (see paper)
47% identity, 95% coverage: 3:335/350 of query aligns to 5:329/346 of 1ketA
- active site: T123 (= T130), D124 (= D131), E125 (= E132), Y159 (= Y157), K163 (= K161)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), F13 (= F11), I14 (= I12), D35 (= D31), K36 (≠ A32), L37 (= L33), T38 (= T34), A40 (= A36), G41 (≠ A37), D60 (= D57), I61 (= I58), Y80 (≠ L79), A82 (= A81), S84 (= S83), T99 (= T98), S122 (= S129), T123 (= T130), Y159 (= Y157), K163 (= K161)
- binding thymidine-5'-diphosphate: E125 (= E132), N188 (= N186), F199 (≠ L197), R202 (≠ V200), Q203 (≠ V201), K214 (≠ P212), Y216 (= Y214), R223 (= R221), N258 (= N256), R282 (= R289), H285 (= H292)
1kepA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with dtdp-xylose bound (see paper)
47% identity, 95% coverage: 3:335/350 of query aligns to 5:329/346 of 1kepA
- active site: T123 (= T130), D124 (= D131), E125 (= E132), Y159 (= Y157), K163 (= K161)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), F13 (= F11), I14 (= I12), D35 (= D31), K36 (≠ A32), L37 (= L33), T38 (= T34), G41 (≠ A37), D60 (= D57), I61 (= I58), Y80 (≠ L79), A81 (= A80), A82 (= A81), S84 (= S83), T99 (= T98), S122 (= S129), Y159 (= Y157), K163 (= K161), N189 (= N187)
- binding thymidine-5'-diphospho-beta-d-xylose: S84 (= S83), T123 (= T130), E125 (= E132), Y159 (= Y157), N188 (= N186), K198 (= K196), R223 (= R221), R282 (= R289)
1kerB The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with dtdp-d-glucose bound (see paper)
47% identity, 95% coverage: 3:335/350 of query aligns to 6:330/347 of 1kerB
- active site: T124 (= T130), D125 (= D131), E126 (= E132), Y160 (= Y157), K164 (= K161)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S85 (= S83), N87 (≠ V85), T124 (= T130), D125 (= D131), E126 (= E132), Y160 (= Y157), N189 (= N186), K199 (= K196), F200 (≠ L197), R203 (≠ V200), Q204 (≠ V201), K215 (≠ P212), L216 (≠ I213), Y217 (= Y214), R224 (= R221), N259 (= N256), R283 (= R289), H286 (= H292)
- binding nicotinamide-adenine-dinucleotide: G13 (= G10), F14 (= F11), I15 (= I12), D36 (= D31), K37 (≠ A32), L38 (= L33), T39 (= T34), G42 (≠ A37), D61 (= D57), I62 (= I58), Y81 (≠ L79), A82 (= A80), A83 (= A81), S85 (= S83), T100 (= T98), S123 (= S129), T124 (= T130), Y160 (= Y157), K164 (= K161), C187 (= C184), N190 (= N187)
2hunA Crystal structure of hypothetical protein ph0414 from pyrococcus horikoshii ot3
46% identity, 96% coverage: 1:336/350 of query aligns to 2:316/329 of 2hunA
- active site: T125 (= T130), D126 (= D131), E127 (= E132), Y149 (= Y157), K153 (= K161)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (= I12), D34 (= D31), K35 (≠ A32), S40 (≠ A37), D60 (= D57), V61 (≠ I58), L80 (= L79), A81 (= A80), A82 (= A81), S99 (≠ T98), T125 (= T130), K153 (= K161), C176 (= C184), T177 (≠ S185), N178 (= N186), N179 (= N187)
P95780 dTDP-glucose 4,6-dehydratase; EC 4.2.1.46 from Streptococcus mutans serotype c (strain ATCC 700610 / UA159) (see paper)
45% identity, 95% coverage: 3:335/350 of query aligns to 7:331/348 of P95780
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
46% identity, 96% coverage: 1:337/350 of query aligns to 1:322/322 of 1r66A
- active site: T127 (= T130), D128 (= D131), E129 (= E132), Y151 (= Y157), K155 (= K161)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (= I12), D37 (= D31), S38 (≠ A32), L39 (= L33), T40 (= T34), G43 (≠ A37), D63 (= D57), I64 (= I58), F83 (≠ L79), A84 (= A80), A85 (= A81), S87 (= S83), T102 (= T98), V125 (≠ I128), S126 (= S129), Y151 (= Y157), K155 (= K161), N181 (= N187)
- binding thymidine-5'-diphosphate: H88 (= H84), E129 (= E132), N180 (= N186), K190 (= K196), L191 (= L197), P206 (= P212), Y208 (= Y214), R215 (= R221), N250 (= N256), R274 (= R289), H277 (= H292)
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
46% identity, 96% coverage: 1:337/350 of query aligns to 1:322/322 of 1r6dA
- active site: T127 (= T130), N128 (≠ D131), Q129 (≠ E132), Y151 (= Y157), K155 (= K161)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (= S83), H88 (= H84), T127 (= T130), N128 (≠ D131), Q129 (≠ E132), Y151 (= Y157), N180 (= N186), K190 (= K196), L191 (= L197), P206 (= P212), Y208 (= Y214), R215 (= R221), N250 (= N256), R274 (= R289), H277 (= H292), Y281 (= Y296)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (= I12), D37 (= D31), S38 (≠ A32), L39 (= L33), T40 (= T34), A42 (= A36), G43 (≠ A37), D63 (= D57), I64 (= I58), F83 (≠ L79), A84 (= A80), A85 (= A81), S87 (= S83), T102 (= T98), V125 (≠ I128), S126 (= S129), Y151 (= Y157), K155 (= K161), N181 (= N187)
Q9LPG6 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2; NDP-rhamnose synthase; Protein MUCILAGE-MODIFIED 4; Protein RHAMNOSE BIOSYNTHESIS 2; Rhamnose biosynthetic enzyme 2; AtRHM2; UDP-L-rhamnose synthase MUM4; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
40% identity, 95% coverage: 3:333/350 of query aligns to 11:328/667 of Q9LPG6
- G18 (= G10) mutation to A: Abolishes dehydratase activity.
- K36 (≠ Q26) mutation to A: Reduces dehydratase activity.
- D96 (= D86) mutation to N: In mum4-1; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
- K165 (= K161) mutation to A: Abolishes dehydratase activity.
- G193 (= G189) mutation to R: In mum4-2; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
Sites not aligning to the query:
- 392 G→A: No effect on dehydratase activity.
- 413 K→A: No effect on dehydratase activity.
- 518 K→A: No effect on dehydratase activity.
8sk0A Crystal structure of evds6 decarboxylase in ligand bound state (see paper)
44% identity, 97% coverage: 2:339/350 of query aligns to 8:327/329 of 8sk0A
- binding nicotinamide-adenine-dinucleotide: G16 (= G10), F17 (= F11), I18 (= I12), D43 (= D31), S44 (≠ A32), L45 (= L33), T46 (= T34), G49 (≠ A37), D67 (= D57), F87 (≠ L79), A88 (= A80), A89 (= A81), T91 (≠ S83), T106 (= T98), V129 (≠ I128), S130 (= S129), T131 (= T130), Y155 (= Y157), K159 (= K161)
- binding thymidine-5'-diphosphate: E133 (= E132), N184 (= N186), K194 (= K196), V195 (≠ L197), P210 (= P212), Y212 (= Y214), R219 (= R221), N254 (= N256), R278 (= R289), H281 (= H292)
8sk0B Crystal structure of evds6 decarboxylase in ligand bound state (see paper)
44% identity, 97% coverage: 2:339/350 of query aligns to 9:328/330 of 8sk0B
- binding nicotinamide-adenine-dinucleotide: G17 (= G10), F18 (= F11), I19 (= I12), D44 (= D31), S45 (≠ A32), L46 (= L33), T47 (= T34), G50 (≠ A37), D68 (= D57), I69 (= I58), F88 (≠ L79), A89 (= A80), A90 (= A81), T92 (≠ S83), T107 (= T98), V130 (≠ I128), Y156 (= Y157), K160 (= K161), G184 (≠ S185), N186 (= N187)
Q9SYM5 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1; Protein REPRESSOR OF LRX1 1; Rhamnose biosynthetic enzyme 1; AtRHM1; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
41% identity, 95% coverage: 3:333/350 of query aligns to 9:326/669 of Q9SYM5
- R283 (= R289) mutation to K: In rol1-2; Abolishes dehydratase activity in vitro (PubMed:16766693). Induces aberrant accumulation of flavonols leading to alterations in plant growth and cell shape formation (PubMed:18567791, PubMed:18757557).
6vloA X-ray structure of the r141 sugar 4,6-dehydratase from acanthamoeba polyphaga minivirus (see paper)
36% identity, 93% coverage: 2:326/350 of query aligns to 5:312/319 of 6vloA
- active site: T126 (= T130), D127 (= D131), E128 (= E132), Y151 (= Y157), K155 (= K161)
- binding nicotinamide-adenine-dinucleotide: G10 (= G7), G13 (= G10), F14 (= F11), I15 (= I12), D36 (= D31), I37 (≠ A32), A42 (= A37), D59 (= D57), I60 (= I58), F81 (≠ L79), A82 (= A80), A83 (= A81), S85 (= S83), M124 (≠ I128), T126 (= T130), K155 (= K161)
- binding thymidine-5'-diphosphate: N180 (= N186), K190 (= K196), L191 (= L197), K194 (≠ V200), H206 (≠ P212), Q208 (≠ Y214), R215 (= R221), V250 (≠ N256), R275 (= R289), R281 (= R295)
Query Sequence
>GFF3921 FitnessBrowser__Phaeo:GFF3921
MKILVTGGAGFIGSAVVRLAVARGHQVVNLDALTYAACLDNVAAVADSPNYAFEQVDIRD
RAALDTVFARHRPDVVMHLAAESHVDRSIDGPGDFIETNITGTYQMLEAARKYWAEAGRP
EAFRFHHISTDEVYGSLPADPSVMFTEETGYDPRSPYSASKAASDHLVRAWGETYGLPVV
LTNCSNNYGPYHFPEKLIPVVILNALAGKPLPIYGDGSNVRDWLYVEDHADALLLVVSKG
RVGRSYNIGGENERTNLELVETLCAILDEKRPREDGGSYKDQITFVTDRPGHDARYAIDP
SRIRDELGWRPSVTVEEGLARTVQWYLDNESWWRALQSRDGVGQRLGVKA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory