Comparing GFF393 FitnessBrowser__Phaeo:GFF393 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7fixR1 Photosystem I reaction center subunit PsaK (see paper)
49% identity, 21% coverage: 275:349/357 of query aligns to 11:85/97 of 7fixR1
6khi1 Supercomplex for cylic electron transport in cyanobacteria (see paper)
49% identity, 21% coverage: 275:349/357 of query aligns to 12:86/98 of 6khi1
1rfkB Crystal structure of 2fe2s ferredoxin from thermophilic cyanobacterium mastigocladus laminosus (see paper)
47% identity, 22% coverage: 275:352/357 of query aligns to 12:89/97 of 1rfkB
7s3dX Structure of photosystem i with bound ferredoxin from synechococcus sp. Pcc 7335 acclimated to far-red light (see paper)
47% identity, 22% coverage: 280:357/357 of query aligns to 16:93/97 of 7s3dX
6kbhA Crystal structure of an intact type iv self-sufficient cytochrome p450 monooxygenase
25% identity, 89% coverage: 7:322/357 of query aligns to 456:732/765 of 6kbhA
Sites not aligning to the query:
5aukA Crystal structure of the ga-substituted ferredoxin (see paper)
45% identity, 25% coverage: 265:352/357 of query aligns to 1:87/96 of 5aukA
2kajA Nmr structure of gallium substituted ferredoxin (see paper)
45% identity, 25% coverage: 265:352/357 of query aligns to 1:87/96 of 2kajA
1doxA 1h and 15n sequential assignment, secondary structure and tertiary fold of [2fe-2s] ferredoxin from synechocystis sp. Pcc 6803 (see paper)
45% identity, 25% coverage: 265:352/357 of query aligns to 1:87/96 of 1doxA
P27320 Ferredoxin-1; Ferredoxin I from Synechocystis sp. (strain PCC 6803 / Kazusa) (see 3 papers)
45% identity, 25% coverage: 265:352/357 of query aligns to 2:88/97 of P27320
Sites not aligning to the query:
3b2gA Leptolyngbya boryana ferredoxin (see paper)
42% identity, 23% coverage: 275:357/357 of query aligns to 12:94/98 of 3b2gA
P0A3C7 Ferredoxin-1; Ferredoxin I from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) (see paper)
45% identity, 22% coverage: 275:352/357 of query aligns to 13:90/99 of P0A3C7
Sites not aligning to the query:
1ewyC Anabaena pcc7119 ferredoxin:ferredoxin-NADP+-reductase complex (see paper)
45% identity, 22% coverage: 275:352/357 of query aligns to 12:89/98 of 1ewyC
1czpA Anabaena pcc7119 [2fe-2s] ferredoxin in the reduced and oxixized state at 1.17 a (see paper)
45% identity, 22% coverage: 275:352/357 of query aligns to 12:89/98 of 1czpA
6yacN Plant psi-ferredoxin supercomplex (see paper)
47% identity, 23% coverage: 272:352/357 of query aligns to 8:87/97 of 6yacN
1awdA Ferredoxin [2fe-2s] oxidized form from chlorella fusca (see paper)
40% identity, 25% coverage: 269:357/357 of query aligns to 2:90/94 of 1awdA
P56408 Ferredoxin from Scenedesmus fuscus (Green alga) (Chlorella fusca) (see paper)
40% identity, 25% coverage: 269:357/357 of query aligns to 2:90/94 of P56408
P27787 Ferredoxin-1, chloroplastic; Ferredoxin I; Fd I from Zea mays (Maize) (see 2 papers)
41% identity, 23% coverage: 272:352/357 of query aligns to 60:139/150 of P27787
Sites not aligning to the query:
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
27% identity, 67% coverage: 9:248/357 of query aligns to 104:333/333 of 5ogxA
Sites not aligning to the query:
4fxcA Tertiary structure of [2fe-2s] ferredoxin from spirulina platensis refined at 2.5 angstroms resolution: structural comparisons of plant-type ferredoxins and an electrostatic potential analysis (see paper)
42% identity, 22% coverage: 275:352/357 of query aligns to 12:89/98 of 4fxcA
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
27% identity, 67% coverage: 9:248/357 of query aligns to 105:334/334 of P0DPQ8
Sites not aligning to the query:
>GFF393 FitnessBrowser__Phaeo:GFF393
MARFHDLVVTDVRKTIRDAVVVTLKPVGGAAEEFDFTQGQYLTFRRDFDGEELRRSYSIC
AGKDEGILQVGIKRVDGGAFSTWANTELKAGDTLQAMAPMGSFFTPLNEAAEKHYLGFAG
GSGITPVLSILKTTLAAEPNASFTLVYANKGVNTIMFREELEDLKNLYMGRFNLIHVLES
DAQEIDLFTGLVTEEKCAQLFERWIDIKSVDTAFICGPEPMMLGIASALRTAGLNDSQIK
FELFASAQPGRAKRKVTAGGTGTGANQTKAAITLDGATQTIEIGKDMTLLDAALENAMDA
PYACKAGVCSTCRCKVLEGEVEMIANHALEDYEVEKGYVLSCQAYPLSDKVVVDYDQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory