Comparing GFF3931 FitnessBrowser__psRCH2:GFF3931 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7rsfA Acetylornithine deacetylase from escherichia coli
50% identity, 97% coverage: 3:378/386 of query aligns to 2:378/380 of 7rsfA
7uoiA Crystallographic structure of dape from enterococcus faecium
26% identity, 89% coverage: 37:378/386 of query aligns to 30:382/383 of 7uoiA
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
29% identity, 86% coverage: 45:375/386 of query aligns to 43:363/366 of Q8P8J5
2f7vA Structure of acetylcitrulline deacetylase complexed with one co (see paper)
29% identity, 86% coverage: 45:375/386 of query aligns to 44:358/360 of 2f7vA
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
27% identity, 91% coverage: 12:363/386 of query aligns to 11:360/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
27% identity, 91% coverage: 12:363/386 of query aligns to 11:360/375 of 4pqaA
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
24% identity, 89% coverage: 36:380/386 of query aligns to 28:377/377 of 7t1qA
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
23% identity, 94% coverage: 13:374/386 of query aligns to 12:371/377 of P44514
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
23% identity, 94% coverage: 13:374/386 of query aligns to 16:375/380 of 5vo3A
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
25% identity, 82% coverage: 43:359/386 of query aligns to 44:380/408 of Q03154
Sites not aligning to the query:
7lgpB Dape enzyme from shigella flexneri
25% identity, 96% coverage: 12:380/386 of query aligns to 13:374/377 of 7lgpB
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
29% identity, 62% coverage: 32:269/386 of query aligns to 40:302/426 of 3pfoA
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
26% identity, 62% coverage: 43:283/386 of query aligns to 44:298/407 of P37111
Sites not aligning to the query:
5xoyA Crystal structure of lysk from thermus thermophilus in complex with lysine (see paper)
26% identity, 90% coverage: 29:375/386 of query aligns to 19:335/341 of 5xoyA
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
32% identity, 34% coverage: 12:143/386 of query aligns to 13:139/258 of 4h2kA
Sites not aligning to the query:
1q7lA Zn-binding domain of the t347g mutant of human aminoacylase-i (see paper)
30% identity, 28% coverage: 43:150/386 of query aligns to 38:149/192 of 1q7lA
Sites not aligning to the query:
1cg2A Carboxypeptidase g2 (see paper)
24% identity, 88% coverage: 35:374/386 of query aligns to 43:383/389 of 1cg2A
7m6uB Crystal structure of a circular permutation and computationally designed pro-enzyme of carboxypeptidase g2 (see paper)
24% identity, 80% coverage: 65:374/386 of query aligns to 11:318/392 of 7m6uB
P06621 Carboxypeptidase G2; CPDG2; Folate hydrolase G2; Glutamate carboxypeptidase; Pteroylmonoglutamic acid hydrolase G2; Glucarpidase; EC 3.4.17.11 from Pseudomonas sp. (strain RS-16) (see paper)
24% identity, 88% coverage: 35:374/386 of query aligns to 68:408/415 of P06621
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
21% identity, 65% coverage: 98:346/386 of query aligns to 94:340/373 of 3rzaA
Sites not aligning to the query:
>GFF3931 FitnessBrowser__psRCH2:GFF3931
MPIPSFKEQFAQLLAAPSVSCTQPGWDQSNRPVIELLAAWLGELGFACETPEVAPGKFNL
LASYGSGPGGLVLAGHSDTVPFDAGLWTSDPLKLREADGRWYGLGSCDMKGFFALIIEAV
RPLLEQPFRRPLLILATCDEESSMSGARALAEAGQPLGRAAVIGEPTGLRPVRLHKGIMM
ERIDILGQSGHSSNPAYGHSALEAMHGVMGEMMTLRRQWQGEYDNPLFDVPKPTLNFGCI
HGGDNPNRICGQCSLEFDLRPLPGMDPQQLRTIIRQRLQPLAEQHQVKIDLAPLFPAVPP
FEQAAESELVRLAERLTGHRAEAVAFATEAPYLQQLGCETLVLGPGDIACAHQPDEYLQL
DRIEPTLQLLRRMIEHYCLQPQTAPN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory