SitesBLAST
Comparing GFF3941 FitnessBrowser__Phaeo:GFF3941 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5u4qA 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
52% identity, 97% coverage: 5:331/336 of query aligns to 5:319/321 of 5u4qA
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), F12 (= F12), I13 (= I13), D32 (= D32), N33 (≠ C33), N35 (≠ S35), Y38 (= Y38), K43 (= K43), D61 (≠ K62), L62 (= L63), L83 (= L84), A84 (= A85), A85 (= A86), A118 (= A126), Y145 (= Y153), K149 (= K157), F172 (= F180), F173 (= F181), T174 (= T182), V175 (= V183), R181 (= R189)
5u4qB 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
49% identity, 97% coverage: 5:331/336 of query aligns to 5:303/304 of 5u4qB
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), F12 (= F12), I13 (= I13), D32 (= D32), N33 (≠ C33), N35 (≠ S35), Y38 (= Y38), K43 (= K43), D61 (≠ K62), L62 (= L63), L83 (= L84), A84 (= A85), A85 (= A86), A123 (= A126), Y150 (= Y153), K154 (= K157), F177 (= F180), V180 (= V183), R186 (= R189), M189 (= M192)
6zllA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-galacturonic acid and NAD (see paper)
32% identity, 98% coverage: 5:334/336 of query aligns to 4:318/321 of 6zllA
- active site: T126 (= T128), S127 (= S129), S128 (= S130), Y149 (= Y153), K153 (= K157)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (= I13), D32 (= D32), H33 (≠ C33), F34 (≠ L34), I35 (≠ S35), K43 (= K43), D62 (≠ K62), I63 (≠ L63), L81 (= L84), A82 (= A85), A83 (= A86), I124 (≠ A126), T126 (= T128), Y149 (= Y153), K153 (= K157), Y176 (≠ F180), V179 (= V183), R185 (= R189), M188 (= M192)
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: P85 (≠ A88), V87 (= V90), R88 (= R91), T126 (= T128), S127 (= S129), Y149 (= Y153), T178 (= T182), R185 (= R189), A189 (= A193), R192 (≠ K196), T204 (≠ D208), F206 (≠ Y210), Q211 (≠ M215), R213 (= R217), I250 (≠ L267), E276 (≠ D293)
6zldA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid and NAD (see paper)
32% identity, 97% coverage: 5:331/336 of query aligns to 4:314/314 of 6zldA
- active site: T126 (= T128), S127 (= S129), S128 (= S130), Y149 (= Y153), K153 (= K157)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (= I13), D32 (= D32), H33 (≠ C33), F34 (≠ L34), I35 (≠ S35), K43 (= K43), D62 (≠ K62), I63 (≠ L63), L81 (= L84), A82 (= A85), A83 (= A86), I124 (≠ A126), T126 (= T128), K153 (= K157), Y176 (≠ F180), T178 (= T182), R185 (= R189), M188 (= M192)
- binding uridine-5'-diphosphate-glucuronic acid: P85 (≠ A88), R88 (= R91), T126 (= T128), S127 (= S129), S128 (= S130), Y149 (= Y153), F177 (= F181), T178 (= T182), R185 (= R189), M188 (= M192), A189 (= A193), R192 (≠ K196), T204 (≠ D208), F206 (≠ Y210), Q211 (≠ M215), R213 (= R217), I250 (≠ L267), E276 (≠ D293)
6zl6A Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp and NAD (see paper)
32% identity, 97% coverage: 5:331/336 of query aligns to 4:314/314 of 6zl6A
- active site: T126 (= T128), S127 (= S129), S128 (= S130), Y149 (= Y153), K153 (= K157)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (= I13), D32 (= D32), H33 (≠ C33), F34 (≠ L34), I35 (≠ S35), K43 (= K43), D62 (≠ K62), I63 (≠ L63), L81 (= L84), A82 (= A85), A83 (= A86), I124 (≠ A126), T126 (= T128), K153 (= K157), Y176 (≠ F180), T178 (= T182), V179 (= V183), R185 (= R189), M188 (= M192)
- binding uridine-5'-diphosphate: T178 (= T182), A189 (= A193), R192 (≠ K196), T204 (≠ D208), F206 (≠ Y210), Q211 (≠ M215), R213 (= R217), I250 (≠ L267), E276 (≠ D293)
6zljA Crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and NAD (see paper)
31% identity, 97% coverage: 5:331/336 of query aligns to 4:314/314 of 6zljA
- active site: T126 (= T128), S127 (= S129), S128 (= S130), F149 (≠ Y153), K153 (= K157)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (= I13), D32 (= D32), H33 (≠ C33), F34 (≠ L34), I35 (≠ S35), K43 (= K43), D62 (≠ K62), I63 (≠ L63), L81 (= L84), A82 (= A85), A83 (= A86), I124 (≠ A126), T126 (= T128), K153 (= K157), Y176 (≠ F180), T178 (= T182), V179 (= V183), R185 (= R189), M188 (= M192)
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: P85 (≠ A88), R88 (= R91), T126 (= T128), S127 (= S129), S128 (= S130), F149 (≠ Y153), F177 (= F181), T178 (= T182), R185 (= R189), M188 (= M192), A189 (= A193), R192 (≠ K196), T204 (≠ D208), F206 (≠ Y210), Q211 (≠ M215), R213 (= R217), I250 (≠ L267), E276 (≠ D293)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
30% identity, 96% coverage: 5:328/336 of query aligns to 4:305/309 of 4zrnA
- active site: T117 (= T128), G119 (≠ S130), A120 (= A131), Y143 (= Y153), K147 (= K157), Y181 (≠ W187), G185 (≠ D191)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (= I13), D31 (= D32), N32 (≠ C33), S34 (= S35), S35 (≠ P36), G36 (≠ Y37), S51 (≠ A54), I52 (≠ L63), L73 (= L84), A74 (= A85), A75 (= A86), T92 (≠ A103), S115 (≠ A126), S116 (= S127), Y143 (= Y153), K147 (= K157), Y170 (≠ F180), V173 (= V183)
- binding uridine-5'-diphosphate-glucose: T117 (= T128), G119 (≠ S130), A120 (= A131), Y143 (= Y153), N172 (≠ T182), G185 (≠ D191), V186 (≠ M192), H201 (≠ D208), F203 (≠ Y210), Y208 (≠ M215), R210 (= R217), V244 (≠ L267), R267 (≠ Q290), D270 (= D293)
1sb9A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-glucose (see paper)
31% identity, 97% coverage: 2:327/336 of query aligns to 16:335/340 of 1sb9A
- active site: S141 (≠ T128), S142 (= S129), S143 (= S130), Y165 (= Y153), K169 (= K157), N203 (≠ D191)
- binding nicotinamide-adenine-dinucleotide: G22 (= G8), G25 (= G11), F26 (= F12), I27 (= I13), D46 (= D32), N47 (≠ C33), F48 (≠ L34), T50 (≠ P36), G51 (≠ Y37), D77 (≠ K62), I78 (≠ L63), Q97 (≠ L84), A99 (= A86), T116 (≠ A103), A139 (= A126), A140 (≠ S127), Y165 (= Y153), K169 (= K157), Y192 (≠ F180), N194 (≠ T182), V195 (= V183)
- binding uridine-5'-diphosphate-glucose: S141 (≠ T128), Y165 (= Y153), N194 (≠ T182), A208 (vs. gap), V209 (vs. gap), W213 (≠ F197), Y224 (≠ D208), I225 (≠ V209), N226 (≠ Y210), L270 (= L267), R298 (≠ Q290), D301 (= D293)
1sb8A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-n-acetylgalactosamine (see paper)
31% identity, 97% coverage: 2:327/336 of query aligns to 17:336/341 of 1sb8A
- active site: S142 (≠ T128), S143 (= S129), S144 (= S130), Y166 (= Y153), K170 (= K157), N204 (≠ D191)
- binding nicotinamide-adenine-dinucleotide: G23 (= G8), G26 (= G11), F27 (= F12), I28 (= I13), D47 (= D32), N48 (≠ C33), F49 (≠ L34), T51 (≠ P36), G52 (≠ Y37), D78 (≠ K62), I79 (≠ L63), Q98 (≠ L84), A100 (= A86), T117 (≠ A103), A140 (= A126), A141 (≠ S127), Y166 (= Y153), K170 (= K157), Y193 (≠ F180), N195 (≠ T182), V196 (= V183)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (≠ G89), S142 (≠ T128), S143 (= S129), S144 (= S130), Y166 (= Y153), N195 (≠ T182), A209 (vs. gap), V210 (vs. gap), W214 (≠ F197), Y225 (≠ D208), I226 (≠ V209), N227 (≠ Y210), R234 (= R217), L271 (= L267), R299 (≠ Q290), D302 (= D293), S306 (≠ T297)
3ruhA Alternative analogs as viable substrates of udp-hexose 4-epimerases
31% identity, 97% coverage: 2:327/336 of query aligns to 17:331/336 of 3ruhA
- active site: S142 (≠ T128), S143 (= S129), S144 (= S130), Y166 (= Y153), K170 (= K157), N204 (≠ D191)
- binding nicotinamide-adenine-dinucleotide: G23 (= G8), G26 (= G11), F27 (= F12), I28 (= I13), D47 (= D32), N48 (≠ C33), S50 (= S35), T51 (≠ P36), G52 (≠ Y37), D78 (≠ K62), I79 (≠ L63), Q98 (≠ L84), A99 (= A85), A100 (= A86), T117 (≠ A103), A140 (= A126), A141 (≠ S127), S142 (≠ T128), Y166 (= Y153), K170 (= K157), Y193 (≠ F180), V196 (= V183)
- binding [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl][(2R,3R,4R,5R,6R)-6-(hydroxymethyl)-4,5-bis(oxidanyl)-3-(2-oxidanylidenepropyl)oxan-2-yl] hydrogen phosphate: G102 (≠ A88), S103 (≠ G89), S142 (≠ T128), S143 (= S129), S144 (= S130), Y166 (= Y153), Y193 (≠ F180), N195 (≠ T182), A209 (vs. gap), V210 (vs. gap), K213 (= K196), W214 (≠ F197), Y225 (≠ D208), I226 (≠ V209), N227 (≠ Y210), R234 (= R217), L271 (= L267), R294 (≠ Q290), D297 (= D293), V298 (= V294), S301 (≠ T297)
3rufA Alternative analogs as viable substrates of udp-hexose 4-epimerases
31% identity, 97% coverage: 2:327/336 of query aligns to 17:331/336 of 3rufA
- active site: S142 (≠ T128), S143 (= S129), S144 (= S130), Y166 (= Y153), K170 (= K157), N204 (≠ D191)
- binding nicotinamide-adenine-dinucleotide: G23 (= G8), G26 (= G11), F27 (= F12), I28 (= I13), D47 (= D32), N48 (≠ C33), S50 (= S35), T51 (≠ P36), G52 (≠ Y37), D78 (≠ K62), I79 (≠ L63), Q98 (≠ L84), A99 (= A85), A100 (= A86), T117 (≠ A103), A140 (= A126), Y166 (= Y153), K170 (= K157), Y193 (≠ F180), V196 (= V183)
- binding uridine-5'-diphosphate: N195 (≠ T182), A209 (vs. gap), V210 (vs. gap), K213 (= K196), W214 (≠ F197), Y225 (≠ D208), I226 (≠ V209), N227 (≠ Y210), R234 (= R217), L271 (= L267), R294 (≠ Q290), D297 (= D293)
3lu1A Crystal structure analysis of wbgu: a udp-galnac 4-epimerase (see paper)
31% identity, 97% coverage: 2:327/336 of query aligns to 17:331/336 of 3lu1A
- active site: S142 (≠ T128), S143 (= S129), S144 (= S130), Y166 (= Y153), K170 (= K157), N204 (≠ D191)
- binding glycine: Q135 (≠ A121), K187 (≠ P174)
- binding nicotinamide-adenine-dinucleotide: G23 (= G8), G26 (= G11), F27 (= F12), I28 (= I13), D47 (= D32), N48 (≠ C33), S50 (= S35), T51 (≠ P36), G52 (≠ Y37), D78 (≠ K62), I79 (≠ L63), Q98 (≠ L84), A99 (= A85), A100 (= A86), A140 (= A126), A141 (≠ S127), S142 (≠ T128), Y166 (= Y153), K170 (= K157), Y193 (≠ F180), N195 (≠ T182)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (≠ G89), S142 (≠ T128), S143 (= S129), S144 (= S130), Y166 (= Y153), N195 (≠ T182), V210 (vs. gap), W214 (≠ F197), Y225 (≠ D208), I226 (≠ V209), N227 (≠ Y210), R234 (= R217), L271 (= L267), R294 (≠ Q290), D297 (= D293)
7ysmA Crystal structure of udp-glucose 4-epimerase (rv3634c) co-crystallized with udp-n-acetylglucosamine from mycobacterium tuberculosis
32% identity, 97% coverage: 4:328/336 of query aligns to 3:309/311 of 7ysmA
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (= I13), D31 (= D32), N32 (≠ C33), T35 (≠ P36), G36 (≠ Y37), D56 (≠ K62), I57 (≠ L63), L77 (= L84), A78 (= A85), A79 (= A86), I81 (≠ A88), T119 (≠ I125), Y146 (= Y153), K150 (= K157), P173 (≠ F180), N175 (≠ T182), V176 (= V183)
- binding uridine-diphosphate-n-acetylgalactosamine: I81 (≠ A88), R84 (= R91), S121 (= S127), G123 (≠ S129), S124 (= S130), Y146 (= Y153), A174 (≠ F181), N175 (≠ T182), G188 (≠ M192), V189 (≠ A193), F193 (= F197), R204 (≠ D208), V205 (= V209), F206 (≠ Y210), N211 (≠ M215), R213 (= R217), D248 (≠ L267), R271 (≠ Q290)
7ys9A Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chaina from mycobacterium tuberculosis
32% identity, 97% coverage: 4:328/336 of query aligns to 3:309/310 of 7ys9A
- binding galactose-uridine-5'-diphosphate: I81 (≠ A88), R84 (= R91), S121 (= S127), G123 (≠ S129), Y146 (= Y153), A174 (≠ F181), N175 (≠ T182), A187 (vs. gap), G188 (≠ M192), V189 (≠ A193), F193 (= F197), R204 (≠ D208), F206 (≠ Y210), N211 (≠ M215), R213 (= R217), D248 (≠ L267), R271 (≠ Q290)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (= I13), D31 (= D32), N32 (≠ C33), A34 (≠ S35), T35 (≠ P36), G36 (≠ Y37), D56 (≠ K62), I57 (≠ L63), L77 (= L84), A78 (= A85), A79 (= A86), I81 (≠ A88), T119 (≠ I125), Y146 (= Y153), K150 (= K157), P173 (≠ F180), A174 (≠ F181), V176 (= V183)
- binding uridine-5'-diphosphate-glucose: I81 (≠ A88), R84 (= R91), S121 (= S127), G123 (≠ S129), Y146 (= Y153), A174 (≠ F181), N175 (≠ T182), A187 (vs. gap), G188 (≠ M192), V189 (≠ A193), F193 (= F197), R204 (≠ D208), F206 (≠ Y210), N211 (≠ M215), R213 (= R217), D248 (≠ L267), R271 (≠ Q290)
7ystA Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chain b from mycobacterium tuberculosis
32% identity, 97% coverage: 4:328/336 of query aligns to 3:309/312 of 7ystA
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (= F12), I12 (= I13), D31 (= D32), N32 (≠ C33), T35 (≠ P36), G36 (≠ Y37), D56 (≠ K62), I57 (≠ L63), L77 (= L84), A78 (= A85), A79 (= A86), I81 (≠ A88), V96 (≠ A103), T119 (≠ I125), Y146 (= Y153), K150 (= K157), P173 (≠ F180), A174 (≠ F181), N175 (≠ T182), V176 (= V183)
- binding uridine-5'-diphosphate-glucose: I81 (≠ A88), R84 (= R91), S121 (= S127), G123 (≠ S129), Y146 (= Y153), A174 (≠ F181), N175 (≠ T182), A187 (vs. gap), G188 (≠ M192), V189 (≠ A193), F193 (= F197), R204 (≠ D208), V205 (= V209), F206 (≠ Y210), R213 (= R217), D248 (≠ L267), R271 (≠ Q290)
8du1A Crystal structure of NAD bound dtdp-glucose 4,6-dehydratase from elizabethkingia anophelis
25% identity, 97% coverage: 1:327/336 of query aligns to 3:337/361 of 8du1A
- binding nicotinamide-adenine-dinucleotide: G10 (= G8), G13 (= G11), F14 (= F12), I15 (= I13), D36 (= D32), A37 (≠ C33), L38 (= L34), T39 (≠ S35), G42 (≠ V40), D62 (≠ K62), I63 (≠ L63), L84 (= L84), A85 (= A85), A86 (= A86), T103 (≠ A103), S143 (= S127), T144 (= T128), Y169 (= Y153), K173 (= K157), C196 (≠ F180)
6pmhA Structure of epimerase mth375 from the thermophilic pseudomurein- containing methanogen methanothermobacter thermautotrophicus
27% identity, 97% coverage: 2:327/336 of query aligns to 10:317/330 of 6pmhA
- active site: S127 (≠ T128), C129 (≠ S130), G130 (≠ A131), Y153 (= Y153), K157 (= K157)
- binding adenosine monophosphate: G16 (= G8), G19 (= G11), D40 (= D32), N41 (≠ C33), S43 (= S35), S44 (≠ P36), S45 (≠ Y37), D62 (≠ K62), I63 (≠ L63), A84 (= A85), F87 (≠ A88), R194 (≠ D191)
- binding uridine-5'-diphosphate: C129 (≠ S130), N182 (≠ T182), N195 (≠ M192), V196 (≠ A193), F200 (= F197), P211 (≠ D208), I212 (≠ V209), T213 (≠ Y210), R220 (= R217), V256 (≠ L267), R279 (≠ A296)
Q7BJX9 UDP-N-acetylglucosamine 4-epimerase; UDP-GalNAc 4-epimerase; EC 5.1.3.7 from Plesiomonas shigelloides (Aeromonas shigelloides) (see 2 papers)
30% identity, 97% coverage: 2:327/336 of query aligns to 20:339/345 of Q7BJX9
- GVAGFI 26:31 (≠ GSAGFI 8:13) binding
- DNFSTG 50:55 (≠ DCLSPY 32:37) binding
- DI 81:82 (≠ KL 62:63) binding
- QAA 101:103 (≠ LAA 84:86) binding
- T120 (≠ A103) binding
- SS 145:146 (≠ TS 128:129) binding
- S147 (= S130) mutation to T: No effect on epimerase activity.
- Y169 (= Y153) binding
- K173 (= K157) binding
- YFN 196:198 (≠ FFT 180:182) binding
- V199 (= V183) binding
- VIPK 213:216 (≠ -LFK 194:196) binding
- YIN 228:230 (≠ DVY 208:210) binding
- S236 (= S216) mutation to G: No effect on epimerase activity.
- R237 (= R217) binding
- R271 (≠ P264) mutation to G: No effect on epimerase activity.
- RSGD 302:305 (≠ QPGD 290:293) binding
- R307 (≠ P295) mutation to A: No effect on epimerase activity.
- H308 (≠ A296) mutation to A: No effect on epimerase activity.
- S309 (≠ T297) mutation to Y: Abolishes epimerase activity.
8vr2B Crystal structure of the pcryo_0617 oxidoreductase/decarboxylase from psychrobacter cryohalolentis k5 in the presence of NAD and udp
28% identity, 99% coverage: 2:333/336 of query aligns to 8:317/321 of 8vr2B
- binding nicotinamide-adenine-dinucleotide: G14 (= G8), G17 (= G11), F18 (= F12), I19 (= I13), D37 (≠ Y38), N38 (≠ D39), E40 (≠ R41), R41 (≠ L42), N61 (≠ K62), V62 (≠ L63), A81 (≠ L84), A82 (= A85), A83 (= A86), F124 (≠ A126), K154 (= K157), P177 (≠ F180), N179 (≠ T182)
- binding uridine-5'-diphosphate: R147 (≠ M150), G189 (≠ M192), A190 (= A193), M194 (≠ F197), Y205 (≠ D208), I206 (≠ V209), F207 (≠ Y210), R214 (= R217), I251 (≠ M268)
6pnlA Structure of epimerase mth375 from the thermophilic pseudomurein- containing methanogen methanothermobacter thermautotrophicus
27% identity, 97% coverage: 2:327/336 of query aligns to 16:323/336 of 6pnlA
- active site: S133 (≠ T128), C135 (≠ S130), G136 (≠ A131), Y159 (= Y153), K163 (= K157)
- binding nicotinamide-adenine-dinucleotide: G22 (= G8), G25 (= G11), C26 (≠ F12), D46 (= D32), N47 (≠ C33), L48 (= L34), S49 (= S35), S50 (≠ P36), S51 (≠ Y37), D68 (≠ K62), I69 (≠ L63), L89 (= L84), A91 (= A86), F93 (≠ A88), V108 (≠ A103), S131 (≠ A126), S133 (≠ T128), Y159 (= Y153), K163 (= K157), F186 (= F180), N188 (≠ T182), V189 (= V183), R200 (≠ D191)
- binding uridine-5'-diphosphate: N188 (≠ T182), N201 (≠ M192), V202 (≠ A193), F206 (= F197), P217 (≠ D208), I218 (≠ V209), T219 (≠ Y210), R226 (= R217), V262 (≠ L267), R285 (≠ A296)
Query Sequence
>GFF3941 FitnessBrowser__Phaeo:GFF3941
MKTALITGSAGFIGYHLADRLLAAGWRVIGLDCLSPYYDVRLKECRHARLAEYAGFTPII
GKLEDPDRLMGLFATHKPDAVIHLAAQAGVRHSIDAPRDYLEANLIGTFELLEAARAHPP
AHMLIASTSSAYGANTQMPFDERQQADHQMSFYAATKKAGETMAHSYAHLYGLPTTMFRF
FTVYGPWGRPDMALFKFTQAMQAGQPIDVYNHGRMSRDFTYIDDLVAGITGLIDAVPGDQ
PVSEQDNLSPVAPFRVVNIGASRPTPLMEYIAALETALGITAQKNLMEMQPGDVPATWAD
TSLLNQLTGYEPQVPVEEGVARFVTWYRAYYGDAQG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory