Comparing GFF3941 FitnessBrowser__WCS417:GFF3941 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9I3S3 Guanidinobutyrase; EC 3.5.3.7 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
90% identity, 100% coverage: 1:316/316 of query aligns to 1:319/319 of Q9I3S3
3nioA Crystal structure of pseudomonas aeruginosa guanidinobutyrase (see paper)
90% identity, 99% coverage: 5:316/316 of query aligns to 2:316/316 of 3nioA
Q9I6K2 Guanidinopropionase; EC 3.5.3.17 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
49% identity, 98% coverage: 7:316/316 of query aligns to 7:316/318 of Q9I6K2
3niqA Crystal structure of pseudomonas aeruginosa guanidinopropionase (see paper)
49% identity, 98% coverage: 7:316/316 of query aligns to 4:313/315 of 3niqA
3nipB Crystal structure of pseudomonas aeruginosa guanidinopropionase complexed with 1,6-diaminohexane (see paper)
49% identity, 98% coverage: 7:316/316 of query aligns to 5:314/316 of 3nipB
P0DJQ3 Proclavaminate amidinohydrolase; Proclavaminic acid amidino hydrolase; EC 3.5.3.22 from Streptomyces clavuligerus (see paper)
41% identity, 92% coverage: 15:305/316 of query aligns to 10:304/313 of P0DJQ3
1gq6B Proclavaminate amidino hydrolase from streptomyces clavuligerus (see paper)
41% identity, 92% coverage: 15:305/316 of query aligns to 2:296/301 of 1gq6B
4dz4B X-ray crystal structure of a hypothetical agmatinase from burkholderia thailandensis (see paper)
40% identity, 93% coverage: 17:309/316 of query aligns to 28:314/323 of 4dz4B
7lbaB E. Coli agmatinase (see paper)
39% identity, 91% coverage: 23:309/316 of query aligns to 26:306/310 of 7lbaB
P60651 Agmatinase; Agmatine ureohydrolase; AUH; EC 3.5.3.11 from Escherichia coli (strain K12) (see paper)
39% identity, 91% coverage: 23:309/316 of query aligns to 19:299/306 of P60651
7lolA The structure of agmatinase from e. Coli at 1.8 a displaying urea and agmatine (see paper)
39% identity, 91% coverage: 23:309/316 of query aligns to 9:289/294 of 7lolA
7loxA The structure of agmatinase from e. Coli at 3.2 a displaying guanidine in the active site (see paper)
38% identity, 91% coverage: 23:309/316 of query aligns to 5:279/284 of 7loxA
7esrA Crystal structure of synechocystis sp pcc6803 guanidinium hydrolase (r32) (see paper)
32% identity, 94% coverage: 13:310/316 of query aligns to 50:354/378 of 7esrA
1wogA Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily (see paper)
34% identity, 92% coverage: 17:308/316 of query aligns to 7:296/303 of 1wogA
3lhlA Crystal structure of a putative agmatinase from clostridium difficile
27% identity, 86% coverage: 40:310/316 of query aligns to 10:271/276 of 3lhlA
6vsuE Arginase from arabidopsis thaliana in complex with ornithine (see paper)
34% identity, 85% coverage: 38:306/316 of query aligns to 42:312/318 of 6vsuE
P46637 Arginase 1, mitochondrial; Agmatinase ARGAH1; Arginine amidohydrolase 1; AtARGAH1; EC 3.5.3.1; EC 3.5.3.11 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
34% identity, 85% coverage: 38:306/316 of query aligns to 66:336/342 of P46637
Sites not aligning to the query:
3pzlB The crystal structure of agmatine ureohydrolase of thermoplasma volcanium
33% identity, 84% coverage: 40:303/316 of query aligns to 28:278/293 of 3pzlB
6vstA Arginase from medicago truncatula in complex with ornithine (see paper)
34% identity, 85% coverage: 37:306/316 of query aligns to 40:311/317 of 6vstA
G7JFU5 Arginase, mitochondrial; Agmatinase ARGAH; Arginine amidohydrolase; MtARGAH; EC 3.5.3.1; EC 3.5.3.11 from Medicago truncatula (Barrel medic) (Medicago tribuloides) (see paper)
34% identity, 85% coverage: 37:306/316 of query aligns to 61:332/338 of G7JFU5
>GFF3941 FitnessBrowser__WCS417:GFF3941
MDKIFHQPLGGNEMPRFAGIATMMRLPHLQTAKGLDAAFIGVPLDIGTSLRAGTRFGPRE
IRAESVMIRPYNMATGAAPFDSLSVADIGDVAINTFNLLDAVRIIEEAYDEILEHDVIPL
TLGGDHTITLPILRAIHKKHGKVGLVHIDAHADVNDHMFGEKIAHGTTFRRAVEEGLLDC
DRVVQIGLRAQGYTAEDFNWSRKQGFRVVQAEECWHHSLAPLMAEVREKVDGGPVYLSFD
IDGIDPAWAPGTGTPEIGGLTTIQAIEIIRGCQGLDLIGCDLVEVSPPYDTTGNTSLLGA
NLLYEMLCVLPGVAHR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory