Comparing GFF3941 FitnessBrowser__psRCH2:GFF3941 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5cm6A Crystal structure of a trap periplasmic solute binding protein from pseudoalteromonas atlantica t6c(patl_2292, target efi-510180) with bound sodium and pyruvate
42% identity, 85% coverage: 40:351/367 of query aligns to 1:313/331 of 5cm6A
4petA Crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate (see paper)
40% identity, 87% coverage: 40:360/367 of query aligns to 2:323/329 of 4petA
7ug8B Crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium
42% identity, 86% coverage: 44:359/367 of query aligns to 7:322/330 of 7ug8B
Q3J1R2 Alpha-keto acid-binding periplasmic protein TakP; Extracytoplasmic solute receptor protein TakP; TRAP transporter alpha-keto acid-binding subunit P; TRAP-T family sorbitol/mannitol transporter, periplasmic binding protein, SmoM from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
37% identity, 87% coverage: 43:361/367 of query aligns to 33:351/365 of Q3J1R2
2hzlB Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms (see paper)
37% identity, 87% coverage: 43:361/367 of query aligns to 5:323/337 of 2hzlB
4yicA Crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi- 500035) with bound picolinic acid
40% identity, 80% coverage: 41:335/367 of query aligns to 4:298/344 of 4yicA
Q5SK82 Lactate-binding periplasmic protein TTHA0766; ABC transporter, solute-binding protein; Extracytoplasmic solute receptor protein TTHA0766; TRAP transporter lactate-binding subunit P from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
28% identity, 95% coverage: 1:349/367 of query aligns to 4:346/361 of Q5SK82
Sites not aligning to the query:
2zzwA Crystal structure of a periplasmic substrate binding protein in complex with zinc and lactate (see paper)
27% identity, 84% coverage: 40:349/367 of query aligns to 1:315/330 of 2zzwA
2zzvA Crystal structure of a periplasmic substrate binding protein in complex with calcium and lactate (see paper)
27% identity, 84% coverage: 40:349/367 of query aligns to 1:315/330 of 2zzvA
4pe3A Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3620, target efi-510199), apo open structure (see paper)
27% identity, 78% coverage: 64:349/367 of query aligns to 22:308/315 of 4pe3A
4uabA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound ethanolamine (see paper)
27% identity, 84% coverage: 41:347/367 of query aligns to 1:302/315 of 4uabA
4xf5A Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound (s)-(+)-2-amino-1-propanol.
27% identity, 84% coverage: 41:347/367 of query aligns to 2:303/317 of 4xf5A
7e9yA Crystal structure of elacco1 (see paper)
27% identity, 50% coverage: 40:221/367 of query aligns to 1:182/563 of 7e9yA
Sites not aligning to the query:
4n6dA Crystal structure of a trap periplasmic solute binding protein from desulfovibrio salexigens dsm2638 (desal_3247), target efi-510112, phased with i3c, open complex, c-terminus of symmetry mate bound in ligand binding site (see paper)
24% identity, 76% coverage: 52:331/367 of query aligns to 14:297/319 of 4n6dA
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
28% identity, 77% coverage: 72:353/367 of query aligns to 30:299/300 of 4n8yA
Sites not aligning to the query:
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
24% identity, 74% coverage: 57:329/367 of query aligns to 20:290/310 of 7bbrA
Sites not aligning to the query:
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
24% identity, 74% coverage: 57:329/367 of query aligns to 19:289/310 of 7bcrA
Sites not aligning to the query:
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
24% identity, 74% coverage: 57:329/367 of query aligns to 19:289/310 of 7bcpA
Sites not aligning to the query:
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
24% identity, 74% coverage: 57:329/367 of query aligns to 19:289/310 of 7bcoA
Sites not aligning to the query:
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
24% identity, 74% coverage: 57:329/367 of query aligns to 19:289/310 of 7bcnA
>GFF3941 FitnessBrowser__psRCH2:GFF3941
MKRRDILTAAGVGLAATALAGCNDKSDKPVAGESKQAEQQTFNWKMVTSWPKNFPGVGVG
AERFANLVNEMSGGRLKIKVYAAGELVPALEVFDAVSRGTAEMGHGAPYYWKGKVPAAQF
FCALPFGPNAQEMNAWLHRGGGMQLWEEVYKPYGVLPMACGATGVQTAGWFNKEINSVDD
FKGLKMRTPGLGGEVLTKMGGTVVNMPAGEIFTALQTGAIDATEWIGPYNDLALGLHKAS
KYYYTPGWQEPNVTFELDVNLKAWDTLPDDLKAIVRAAARDVNGDMLDDYNAKNMEALEQ
LREQGVEVRRLPDEVLARLKEVAAEVVDASAKADPVASKVWEQQSAYLKRLYDYAELNEK
DIYNIRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory