SitesBLAST
Comparing GFF3976 FitnessBrowser__Marino:GFF3976 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6yu5A Crystal structure of mhst in complex with l-valine (see paper)
44% identity, 95% coverage: 16:459/465 of query aligns to 2:437/441 of 6yu5A
6yu3A Crystal structure of mhst in complex with l-phenylalanine (see paper)
44% identity, 95% coverage: 16:459/465 of query aligns to 2:437/441 of 6yu3A
6yu2A Crystal structure of mhst in complex with l-isoleucine (see paper)
44% identity, 95% coverage: 16:459/465 of query aligns to 2:437/441 of 6yu2A
4us3A Crystal structure of the bacterial nss member mhst in an occluded inward-facing state (see paper)
44% identity, 95% coverage: 16:459/465 of query aligns to 2:437/441 of 4us3A
- binding sodium ion: G17 (= G31), A19 (= A33), V20 (= V34), V20 (= V34), G21 (= G35), N24 (= N38), T224 (= T241), D256 (= D273), A313 (= A330), S316 (≠ T333), S317 (= S334)
- binding tryptophan: S18 (= S32), A19 (= A33), L22 (= L36), G23 (= G37), Y101 (= Y119), F223 (= F240), T224 (= T241), S226 (= S243), M229 (= M246), S320 (= S337), L321 (= L338)
6yu7A Crystal structure of mhst in complex with l-tyrosine (see paper)
44% identity, 95% coverage: 16:459/465 of query aligns to 2:437/442 of 6yu7A
6yu4A Crystal structure of mhst in complex with l-4f-phenylalanine (see paper)
44% identity, 95% coverage: 16:459/465 of query aligns to 2:437/442 of 6yu4A
- binding 4-fluoro-l-phenylalanine: S18 (= S32), A19 (= A33), G21 (= G35), L22 (= L36), G23 (= G37), Y101 (= Y119), F223 (= F240), T224 (= T241), S226 (= S243), M229 (= M246), L321 (= L338)
6yu6B Crystal structure of mhst in complex with l-leucine (see paper)
44% identity, 95% coverage: 16:459/465 of query aligns to 2:437/446 of 6yu6B
4us4A Crystal structure of the bacterial nss member mhst in an occluded inward-facing state (lipidic cubic phase form) (see paper)
44% identity, 94% coverage: 25:459/465 of query aligns to 2:428/433 of 4us4A
- binding (2s)-2,3-dihydroxypropyl(7z)-pentadec-7-enoate: A173 (≠ V200), T180 (= T207), I287 (≠ M313), R288 (≠ P314), L289 (≠ M315)
- binding sodium ion: G8 (= G31), S9 (= S32), A10 (= A33), V11 (= V34), V11 (= V34), N15 (= N38), T215 (= T241), D247 (= D273), A304 (= A330), S307 (≠ T333), S308 (= S334)
- binding tryptophan: S9 (= S32), A10 (= A33), G12 (= G35), G14 (= G37), Y92 (= Y119), F214 (= F240), T215 (= T241), S217 (= S243), M220 (= M246), L312 (= L338)
3gwwA Leucine transporter leut in complex with s-fluoxetine (see paper)
29% identity, 95% coverage: 16:458/465 of query aligns to 1:454/501 of 3gwwA
- binding leucine: A18 (= A33), G20 (= G35), G22 (= G37), Y104 (= Y119), F244 (= F240), T245 (= T241), S247 (= S243), F250 (≠ M246), I350 (≠ L338)
- binding (3S)-N-methyl-3-phenyl-3-[4-(trifluoromethyl)phenoxy]propan-1-amine: L21 (= L36), G22 (= G37), R26 (≠ K41), Y104 (= Y119), A310 (≠ G298), F311 (≠ P299), D392 (= D398), D395 (= D401)
3gwvA Leucine transporter leut in complex with r-fluoxetine (see paper)
29% identity, 95% coverage: 16:458/465 of query aligns to 1:457/498 of 3gwvA
- binding leucine: A18 (= A33), G20 (= G35), G22 (= G37), Y104 (= Y119), F247 (= F240), T248 (= T241), S250 (= S243), F253 (≠ M246)
- binding (3R)-N-methyl-3-phenyl-3-[4-(trifluoromethyl)phenoxy]propan-1-amine: L21 (= L36), R26 (≠ K41), A313 (≠ G298), F314 (≠ P299), L394 (≠ I396), D395 (= D398), D398 (= D401)
2qb4A Crystal structure analysis of leut complexed with l-leucine, sodium and desipramine (see paper)
29% identity, 95% coverage: 16:458/465 of query aligns to 1:457/510 of 2qb4A
- binding 3-(10,11-dihydro-5h-dibenzo[b,f]azepin-5-yl)-n-methylpropan-1-amine: R26 (≠ K41), V29 (≠ Y44), Q30 (≠ V45), I107 (= I122), R187 (= R185), F188 (≠ A186), I191 (= I189), A313 (≠ G298), F314 (≠ P299), F344 (= F329), D395 (= D398)
- binding leucine: A18 (= A33), G20 (= G35), L21 (= L36), G22 (= G37), Y104 (= Y119), F247 (= F240), T248 (= T241), S250 (= S243), F253 (≠ M246)
- binding sodium ion: G16 (= G31), A18 (= A33), V19 (= V34), V19 (= V34), G20 (= G35), N23 (= N38), T248 (= T241), N280 (≠ D273), A345 (= A330), T348 (= T333), S349 (= S334)
3gwuA Leucine transporter leut in complex with sertraline (see paper)
29% identity, 95% coverage: 16:458/465 of query aligns to 1:457/509 of 3gwuA
- binding leucine: A18 (= A33), G20 (= G35), G22 (= G37), Y104 (= Y119), F247 (= F240), T248 (= T241), S250 (= S243), F253 (≠ M246)
- binding (1S,4S)-4-(3,4-dichlorophenyl)-N-methyl-1,2,3,4-tetrahydronaphthalen-1-amine: L25 (≠ W40), R26 (≠ K41), Y104 (= Y119), F247 (= F240), A313 (≠ G298), D395 (= D398), D398 (= D401)
3f4jA Crystal structure of leut bound to glycine and sodium (see paper)
29% identity, 95% coverage: 16:458/465 of query aligns to 1:457/509 of 3f4jA
- binding glycine: A18 (= A33), G20 (= G35), G22 (= G37), Y104 (= Y119), F247 (= F240), T248 (= T241), S250 (= S243)
- binding sodium ion: G16 (= G31), A18 (= A33), V19 (= V34), V19 (= V34), G20 (= G35), G22 (= G37), N23 (= N38), T248 (= T241), N280 (≠ D273), A345 (= A330), G346 (≠ A331), T348 (= T333), S349 (= S334)
3f3dA Crystal structure of leut bound to l-methionine and sodium (see paper)
29% identity, 95% coverage: 16:458/465 of query aligns to 1:457/509 of 3f3dA
- binding methionine: N17 (≠ S32), A18 (= A33), G20 (= G35), G22 (= G37), Y104 (= Y119), F247 (= F240), T248 (= T241), S250 (= S243), S349 (= S334), I353 (≠ L338)
- binding sodium ion: G16 (= G31), A18 (= A33), V19 (= V34), V19 (= V34), G20 (= G35), N23 (= N38), T248 (= T241), N280 (≠ D273), A345 (= A330), T348 (= T333), S349 (= S334)
3f3cA Crystal structure of leut bound to 4-fluoro-l-phenylalanine and sodium (see paper)
29% identity, 95% coverage: 16:458/465 of query aligns to 1:457/509 of 3f3cA
- binding sodium ion: G16 (= G31), A18 (= A33), V19 (= V34), V19 (= V34), G20 (= G35), N23 (= N38), T248 (= T241), N280 (≠ D273), A345 (= A330), T348 (= T333), S349 (= S334)
- binding 4-fluoro-l-phenylalanine: N17 (≠ S32), A18 (= A33), G20 (= G35), G22 (= G37), Y104 (= Y119), F247 (= F240), T248 (= T241), S250 (= S243), F253 (≠ M246), S349 (= S334), I353 (≠ L338)
3mpnA F177r1 mutant of leut (see paper)
29% identity, 95% coverage: 16:458/465 of query aligns to 1:457/505 of 3mpnA
- binding leucine: N17 (≠ S32), A18 (= A33), G20 (= G35), L21 (= L36), G22 (= G37), Y104 (= Y119), F247 (= F240), T248 (= T241), S250 (= S243), F253 (≠ M246), S349 (= S334)
- binding S-[(1-oxyl-2,2,5,5-tetramethyl-2,5-dihydro-1H-pyrrol-3-yl)methyl] methanesulfonothioate: C171 (vs. gap), A377 (= A371)
3uspA Crystal structure of leut in heptyl-beta-d-selenoglucoside (see paper)
29% identity, 95% coverage: 16:458/465 of query aligns to 1:457/503 of 3uspA
- binding heptyl 1-seleno-beta-D-glucopyranoside: K117 (≠ H132), L122 (vs. gap), E153 (≠ Q159), I155 (≠ L161), K157 (≠ W163), P158 (≠ H164), F161 (= F167), Y163 (≠ A169), H385 (≠ P384), H385 (≠ P384), L386 (= L385), F389 (= F391), F389 (= F391), L394 (≠ I396), D395 (= D398), D398 (= D401), P439 (vs. gap), Y442 (≠ W443)
- binding leucine: A18 (= A33), G20 (= G35), G22 (= G37), F247 (= F240), T248 (= T241), S250 (= S243), F253 (≠ M246)
- binding sodium ion: G16 (= G31), A18 (= A33), V19 (= V34), V19 (= V34), G20 (= G35), N23 (= N38), T248 (= T241), N280 (≠ D273), A345 (= A330), T348 (= T333), S349 (= S334)
2qeiA Crystal structure analysis of leut complexed with l-alanine, sodium, and clomipramine (see paper)
29% identity, 95% coverage: 15:458/465 of query aligns to 1:458/511 of 2qeiA
- binding alanine: A19 (= A33), G21 (= G35), G23 (= G37), Y105 (= Y119), F248 (= F240), T249 (= T241), S251 (= S243)
- binding 3-(3-chloro-5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: R27 (≠ K41), V30 (≠ Y44), Q31 (≠ V45), Y104 (≠ F118), R180 (≠ Q177), R188 (= R185), F189 (≠ A186), F315 (≠ P299), F345 (= F329), D396 (= D398), D399 (= D401)
- binding sodium ion: G17 (= G31), A19 (= A33), V20 (= V34), V20 (= V34), G21 (= G35), N24 (= N38), T249 (= T241), N281 (≠ D273), A346 (= A330), T349 (= T333), S350 (= S334)
2q72A Crystal structure analysis of leut complexed with l-leucine, sodium, and imipramine (see paper)
29% identity, 95% coverage: 15:458/465 of query aligns to 1:458/511 of 2q72A
- binding 3-(5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: R27 (≠ K41), V30 (≠ Y44), Q31 (≠ V45), R188 (= R185), F189 (≠ A186), I192 (= I189), A314 (≠ G298), F315 (≠ P299), F345 (= F329), D396 (= D398)
- binding leucine: A19 (= A33), G21 (= G35), L22 (= L36), G23 (= G37), Y105 (= Y119), F248 (= F240), T249 (= T241), S251 (= S243), F254 (≠ M246)
- binding sodium ion: G17 (= G31), A19 (= A33), V20 (= V34), V20 (= V34), G21 (= G35), N24 (= N38), T249 (= T241), N281 (≠ D273), A346 (= A330), T349 (= T333), S350 (= S334)
2q6hA Crystal structure analysis of leut complexed with l-leucine, sodium, and clomipramine (see paper)
29% identity, 95% coverage: 15:458/465 of query aligns to 2:459/512 of 2q6hA
- binding 3-(3-chloro-5h-dibenzo[b,f]azepin-5-yl)-n,n-dimethylpropan-1-amine: R28 (≠ K41), Q32 (≠ V45), R189 (= R185), F190 (≠ A186), I193 (= I189), F316 (≠ P299), F346 (= F329), L396 (≠ I396), D397 (= D398)
- binding leucine: A20 (= A33), G22 (= G35), G24 (= G37), Y106 (= Y119), F249 (= F240), T250 (= T241), S252 (= S243), F255 (≠ M246)
- binding sodium ion: G18 (= G31), A20 (= A33), V21 (= V34), V21 (= V34), G22 (= G35), N25 (= N38), T250 (= T241), N282 (≠ D273), A347 (= A330), T350 (= T333), S351 (= S334)
Query Sequence
>GFF3976 FitnessBrowser__Marino:GFF3976
MTQSNSVSGNGSVAARGLWSSRLAFILAATGSAVGLGNIWKFPYVTGENGGGAFVLVYLL
CIAVIGIPIMMAEVFIGRNGRHNPITSMRLVAERNLSAPGWRISAIIGMIAAFVILSFYS
VIGGWAASYVGHAAMGDFTGGTADSIGELFGGLLASPGQLLLWHTIFMALVILVVSQGLK
GGLERAVTILMPALFLLLLVAVGYATTTGHFGEAVSFLFTPDFGALTINGVLIALGHAFF
TLSLGMAIMMAYGSYLGRDVSIGRTAVSVAIMDTVVALLAGLAIFPVVFANGLEAGAGPG
LIFQTLPLAFGNMPMGGLFGTLFFILLLFAAWTSGISLLEPVVEWVEEKTSLARTGSSIL
VGVLCWALGIASILSLNVWADVAPLAMFERFEGKTIFDLLDFFTANVLLPLSGLLTAVFV
GWFVAKESLKSDLALQGGAFTLWYNLIRFVTPIAVAIVFFYNLMS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory