SitesBLAST
Comparing GFF3988 FitnessBrowser__Marino:GFF3988 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P26440 Isovaleryl-CoA dehydrogenase, mitochondrial; IVD; Butyryl-CoA dehydrogenase; EC 1.3.8.4; EC 1.3.8.1 from Homo sapiens (Human) (see 5 papers)
30% identity, 93% coverage: 5:354/378 of query aligns to 45:398/426 of P26440
- 165:174 (vs. 123:132, 20% identical) binding
- S174 (≠ Y132) binding
- WIT 198:200 (≠ VVI 156:158) binding
- SR 222:223 (≠ -E 180) binding
- G250 (= G204) to A: in IVA; uncertain significance
- Y277 (≠ E231) binding
- DLER 284:287 (≠ GRAI 238:241) binding
- E286 (≠ A240) active site, Proton acceptor; mutation to D: Residual isovaleryl-CoA dehydrogenase activity.; mutation to G: Loss of isovaleryl-CoA dehydrogenase activity. Does not affect isovaleryl-CoA dehydrogenase activity; when associated with 407-E.; mutation to Q: Loss of isovaleryl-CoA dehydrogenase activity.
- A291 (≠ C245) to V: in IVA; uncertain significance; dbSNP:rs886042098
- R312 (= R266) binding
- Q323 (= Q277) binding
- I379 (= I335) to T: in IVA; uncertain significance
- QCFGG 380:384 (≠ QSHGG 336:340) binding
- R398 (≠ K354) to Q: in IVA; uncertain significance; dbSNP:rs1477527791
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
- 403 Y → N: in IVA; uncertain significance
- 407 A→E: Does not affect isovaleryl-CoA dehydrogenase activity; when associated with 286-D.
- 407:408 binding
- 409:411 binding
1ivhA Structure of human isovaleryl-coa dehydrogenase at 2.6 angstroms resolution: structural basis for substrate specificity (see paper)
30% identity, 93% coverage: 5:354/378 of query aligns to 8:361/387 of 1ivhA
- active site: M130 (≠ L125), S131 (≠ Q126), E249 (≠ S242)
- binding coenzyme a persulfide: S137 (≠ Y132), S185 (vs. gap), R186 (≠ E180), V239 (≠ A230), Y240 (≠ E231), M243 (≠ Q236), E249 (≠ S242), R250 (vs. gap)
- binding flavin-adenine dinucleotide: L128 (≠ V123), M130 (≠ L125), S131 (≠ Q126), G136 (≠ F131), S137 (≠ Y132), W161 (≠ V156), T163 (≠ I158), R275 (= R266), F278 (= F269), F285 (= F276), M288 (≠ L279), Q343 (= Q336), C344 (≠ S337), G347 (= G340)
Sites not aligning to the query:
8sgrA Isovaleryl-CoA dehydrogenase, mitochondrial (see paper)
30% identity, 93% coverage: 5:354/378 of query aligns to 12:365/393 of 8sgrA
- binding flavin-adenine dinucleotide: S135 (≠ Q126), G140 (≠ F131), S141 (≠ Y132), W165 (≠ V156), T167 (≠ I158), R279 (= R266), F282 (= F269), I286 (= I273), F289 (= F276), Q347 (= Q336), C348 (≠ S337), G351 (= G340)
Sites not aligning to the query:
4n5fA Crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315
31% identity, 93% coverage: 1:352/378 of query aligns to 2:354/378 of 4n5fA
Sites not aligning to the query:
5ol2F The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
30% identity, 82% coverage: 39:347/378 of query aligns to 36:346/378 of 5ol2F
- active site: L124 (= L125), T125 (≠ Q126), G241 (≠ A240)
- binding coenzyme a persulfide: L238 (≠ S237), R242 (≠ I241)
- binding flavin-adenine dinucleotide: F122 (≠ V123), L124 (= L125), T125 (≠ Q126), P127 (= P128), T131 (≠ Y132), F155 (≠ V156), I156 (≠ V157), T157 (≠ I158), E198 (≠ R196), R267 (= R266), F270 (= F269), L274 (≠ I273), F277 (= F276), Q335 (= Q336), L336 (≠ S337), G338 (= G339), G339 (= G340)
Sites not aligning to the query:
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
29% identity, 94% coverage: 1:355/378 of query aligns to 1:355/380 of 4l1fA
- active site: L125 (= L125), T126 (≠ Q126), G242 (≠ R239)
- binding coenzyme a persulfide: T132 (≠ Y132), H179 (≠ E180), F232 (≠ A230), M236 (≠ I233), E237 (= E234), L239 (≠ Q236), D240 (≠ S237), R243 (≠ A240)
- binding flavin-adenine dinucleotide: F123 (≠ V123), L125 (= L125), T126 (≠ Q126), G131 (≠ F131), T132 (≠ Y132), F156 (≠ V156), I157 (≠ V157), T158 (≠ I158), R268 (= R266), Q270 (= Q268), F271 (= F269), I275 (= I273), F278 (= F276), L281 (= L279), Q336 (= Q336), I337 (≠ S337), G340 (= G340)
- binding 1,3-propandiol: L5 (= L5), Q10 (= Q10)
Sites not aligning to the query:
P15651 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Rattus norvegicus (Rat) (see 2 papers)
30% identity, 81% coverage: 45:352/378 of query aligns to 72:381/412 of P15651
Sites not aligning to the query:
- 1:24 modified: transit peptide, Mitochondrion
- 392 active site, Proton acceptor
- 394:396 binding
7y0bA Crystal structure of human short-chain acyl-coa dehydrogenase
30% identity, 90% coverage: 5:346/378 of query aligns to 7:348/385 of 7y0bA
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[[4-[(3S)-oxolan-3-yl]oxyphenyl]methyl]phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: M343 (≠ I341), T347 (≠ W345), E348 (= E346)
- binding flavin-adenine dinucleotide: F125 (≠ V123), L127 (= L125), S128 (≠ Q126), G133 (≠ F131), S134 (≠ Y132), W158 (≠ V156), T160 (≠ I158), R270 (= R266), F273 (= F269), L280 (≠ F276), V282 (= V278), Q338 (= Q336), I339 (≠ S337), G342 (= G340)
Sites not aligning to the query:
1jqiA Crystal structure of rat short chain acyl-coa dehydrogenase complexed with acetoacetyl-coa (see paper)
30% identity, 81% coverage: 45:352/378 of query aligns to 45:354/384 of 1jqiA
- binding acetoacetyl-coenzyme a: L95 (= L93), F125 (≠ V123), S134 (≠ Y132), F234 (≠ A230), M238 (≠ E234), Q239 (≠ Y235), L241 (≠ S237), D242 (≠ G238), R245 (≠ I241)
- binding flavin-adenine dinucleotide: F125 (≠ V123), L127 (= L125), S128 (≠ Q126), G133 (≠ F131), S134 (≠ Y132), W158 (≠ V156), T160 (≠ I158), R270 (= R266), F273 (= F269), L280 (≠ F276), Q338 (= Q336), I339 (≠ S337), G342 (= G340)
Sites not aligning to the query:
8sgsA Short-chain specific acyl-CoA dehydrogenase, mitochondrial (see paper)
30% identity, 90% coverage: 5:346/378 of query aligns to 4:345/381 of 8sgsA
- binding coenzyme a: S131 (≠ Y132), A133 (≠ L134), N177 (≠ D178), F231 (≠ A230), M235 (≠ E234), L238 (≠ S237), I312 (≠ E311)
- binding flavin-adenine dinucleotide: F122 (≠ V123), L124 (= L125), S125 (≠ Q126), G130 (≠ F131), S131 (≠ Y132), W155 (≠ V156), T157 (≠ I158), R267 (= R266), F270 (= F269), L274 (≠ I273), L277 (≠ F276), Q335 (= Q336), I336 (≠ S337), G338 (= G339), G339 (= G340)
Sites not aligning to the query:
7y0aC Crystal structure of human short-chain acyl-coa dehydrogenase
30% identity, 90% coverage: 5:346/378 of query aligns to 10:351/387 of 7y0aC
- binding flavin-adenine dinucleotide: F128 (≠ V123), L130 (= L125), S131 (≠ Q126), G136 (≠ F131), S137 (≠ Y132), W161 (≠ V156), T163 (≠ I158), T214 (≠ G207), R273 (= R266), F276 (= F269), L280 (≠ I273), L283 (≠ F276), V285 (= V278), Q341 (= Q336), I342 (≠ S337), G345 (= G340)
Sites not aligning to the query:
P16219 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Homo sapiens (Human) (see 3 papers)
30% identity, 90% coverage: 5:346/378 of query aligns to 34:375/412 of P16219
- G90 (= G63) to S: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs121908005
- E104 (= E77) natural variant: Missing (in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs387906308)
- 152:161 (vs. 123:132, 30% identical) binding in other chain
- R171 (≠ E142) to W: 69% of wild-type acyl-CoA dehydrogenase activity; confers susceptibility to ethylmalonicaciduria; dbSNP:rs1800556
- WIT 185:187 (≠ VVI 156:158) binding in other chain
- A192 (= A163) to V: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28940874
- G209 (= G181) to S: 86% of wild-type acyl-CoA dehydrogenase activity; confers susceptibility to ethylmalonicaciduria; dbSNP:rs1799958
- R297 (= R266) binding
- Q308 (= Q277) binding in other chain
- R325 (= R294) to W: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs121908006
- S353 (≠ G324) to L: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28941773
- QILGG 365:369 (≠ QSHGG 336:340) binding
Sites not aligning to the query:
- 1:24 modified: transit peptide, Mitochondrion
- 380 R → W: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28940875
- 394:396 binding in other chain
2pg0A Crystal structure of acyl-coa dehydrogenase from geobacillus kaustophilus
26% identity, 92% coverage: 5:350/378 of query aligns to 5:351/380 of 2pg0A
- active site: M124 (≠ L125), T125 (≠ Q126), E243 (≠ G238)
- binding flavin-adenine dinucleotide: I122 (≠ V123), M124 (≠ L125), T125 (≠ Q126), G130 (≠ F131), S131 (≠ Y132), F155 (≠ V156), I156 (≠ V157), T157 (≠ I158), R269 (= R266), F272 (= F269), F279 (= F276), Q337 (= Q336), L338 (≠ S337), G340 (= G339), G341 (= G340)
Sites not aligning to the query:
2vigB Crystal structure of human short-chain acyl coa dehydrogenase
30% identity, 90% coverage: 5:346/378 of query aligns to 1:335/371 of 2vigB
- active site: L121 (= L125), S122 (≠ Q126), G231 (≠ A240)
- binding coenzyme a persulfide: S128 (≠ Y132), F221 (≠ A230), M225 (≠ E234), Q226 (≠ Y235), L228 (≠ S237), D229 (≠ G238), R232 (≠ I241)
- binding flavin-adenine dinucleotide: L121 (= L125), S122 (≠ Q126), G127 (≠ F131), S128 (≠ Y132), W152 (≠ V156), T154 (≠ I158), R257 (= R266), F260 (= F269), L264 (≠ I273), L267 (≠ F276), Q325 (= Q336), I326 (≠ S337), G329 (= G340)
Sites not aligning to the query:
6fahD Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
28% identity, 91% coverage: 5:348/378 of query aligns to 3:347/379 of 6fahD
- active site: L124 (= L125), T125 (≠ Q126), G241 (= G238)
- binding flavin-adenine dinucleotide: F122 (≠ V123), L124 (= L125), T125 (≠ Q126), R152 (= R153), F155 (≠ V156), T157 (≠ I158), E198 (≠ P200), R267 (= R266), Q269 (= Q268), F270 (= F269), I274 (= I273), F277 (= F276), Q335 (= Q336), I336 (≠ S337), G339 (= G340)
Sites not aligning to the query:
P51174 Long-chain specific acyl-CoA dehydrogenase, mitochondrial; LCAD; EC 1.3.8.8 from Mus musculus (Mouse) (see paper)
26% identity, 92% coverage: 5:350/378 of query aligns to 53:399/430 of P51174
- K318 (= K267) modified: N6-acetyllysine; mutation to R: Reduces activity by 37%; reduces activity by 80% when associated with R-322.
- K322 (≠ V271) modified: N6-acetyllysine; alternate; mutation to R: Reduces activity by 23%; reduces activity by 80% when associated with R-318.
Sites not aligning to the query:
- 42 modified: N6-acetyllysine; K→R: Reduces activity by 90% when associated with R-318 and R-322.
P28330 Long-chain specific acyl-CoA dehydrogenase, mitochondrial; LCAD; EC 1.3.8.8 from Homo sapiens (Human) (see 2 papers)
27% identity, 92% coverage: 5:350/378 of query aligns to 53:399/430 of P28330
- E291 (≠ A240) active site, Proton acceptor; mutation to Q: Loss of long-chain-acyl-CoA dehydrogenase activity. No effect on protein abundance. No effect on solubility. No effect on substrate binding.
- S303 (≠ M252) to T: in dbSNP:rs1801204
- K333 (≠ R282) to Q: in dbSNP:rs2286963
5lnxD Crystal structure of mmgc, an acyl-coa dehydrogenase from bacillus subtilis.
29% identity, 79% coverage: 7:305/378 of query aligns to 4:304/374 of 5lnxD
- active site: L122 (= L125), T123 (≠ Q126), G239 (≠ A240)
- binding flavin-adenine dinucleotide: L122 (= L125), T123 (≠ Q126), G128 (≠ F131), S129 (≠ Y132), F153 (≠ V156), T155 (≠ I158), R265 (= R266), Q267 (= Q268), F268 (= F269), I272 (= I273), N275 (≠ F276), I278 (≠ L279)
Sites not aligning to the query:
6af6A Piga with fad and proline (see paper)
25% identity, 99% coverage: 1:374/378 of query aligns to 1:376/383 of 6af6A
- active site: A127 (≠ L125), T128 (≠ Q126), A244 (= A240)
- binding flavin-adenine dinucleotide: N125 (≠ V123), A127 (≠ L125), T128 (≠ Q126), G133 (≠ F131), S134 (≠ Y132), F158 (≠ V156), I159 (≠ V157), T160 (≠ I158), W211 (vs. gap), I363 (≠ H361), F364 (≠ Q362), T367 (≠ D365), D369 (= D367), I370 (≠ F368)
- binding 1,4,7,10,13,16-hexaoxacyclooctadecane: L41 (≠ F43), K44 (≠ Q46), K275 (≠ V271), F280 (= F276)
- binding proline: G133 (≠ F131), I136 (≠ L134), F237 (≠ I233), M241 (≠ S237), S365 (≠ L363)
Sites not aligning to the query:
1bucA Three-dimensional structure of butyryl-coa dehydrogenase from megasphaera elsdenii (see paper)
30% identity, 94% coverage: 1:354/378 of query aligns to 1:358/383 of 1bucA
- active site: L128 (= L125), T129 (≠ Q126), G246 (= G238)
- binding acetoacetyl-coenzyme a: L96 (= L93), F126 (≠ V123), G134 (≠ F131), T135 (≠ Y132), T162 (≠ I158), N182 (≠ A179), H183 (≠ E180), F236 (≠ A230), M240 (vs. gap), M241 (≠ I233), L243 (≠ Y235), D244 (≠ Q236), T317 (≠ R314)
- binding flavin-adenine dinucleotide: F126 (≠ V123), L128 (= L125), T129 (≠ Q126), G134 (≠ F131), T135 (≠ Y132), F160 (≠ V156), T162 (≠ I158)
Sites not aligning to the query:
Query Sequence
>GFF3988 FitnessBrowser__Marino:GFF3988
MDFRLNEEQQMLQDTVARLVRGEYSFEKRLEYSESGLGFSADFWKQLGELGLTAVPFPEE
LGGFGGTGVEVQSVMTELGRGLCVEPYLQSVVLGGGLISQAGNSAQQEQWLGGIASGEIR
AAVGLQEPQSFYNLNDVDTRAEKSDDGYVLNGRKAVVIGGHCADVLVVSARTSGDSRDAE
GISLFLIPADAEGVERRTYPTIDGSKGCDLFLNNVQLGTDALLGDEGKAAEVIEYQSGRA
ISALCGEAVGAMEVACDLTLEYLKQRKQFGVPIGKFQVLQHRMVDMMSELEQARSMAILA
ASVADEPQSDERRRILAAAKNVIGRSGQFISEQGIQSHGGIGMTWEYNFAHYAKRLVMIN
HQLGDDDFHLERYAALLK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory