SitesBLAST
Comparing GFF3995 FitnessBrowser__Marino:GFF3995 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ks8C Crystal structure of two-subunit pyruvate carboxylase from methylobacillus flagellatus (see paper)
60% identity, 99% coverage: 5:598/599 of query aligns to 1:600/603 of 5ks8C
- active site: D11 (= D15), D115 (= D119), K172 (= K176), H201 (= H205), H203 (= H207)
- binding manganese (ii) ion: D11 (= D15), K172 (= K176), H201 (= H205), H203 (= H207)
- binding pyruvic acid: L79 (= L83), R81 (= R85), F114 (= F118), M174 (= M178)
5ks8D Crystal structure of two-subunit pyruvate carboxylase from methylobacillus flagellatus (see paper)
59% identity, 99% coverage: 5:598/599 of query aligns to 2:578/580 of 5ks8D
- active site: D12 (= D15), D116 (= D119), K173 (= K176), H202 (= H205), H204 (= H207)
- binding 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal: D51 (= D54), Y56 (≠ F59), M299 (= M302), T337 (= T340), S340 (= S343), Q341 (= Q344)
- binding manganese (ii) ion: D12 (= D15), K173 (= K176), H202 (= H205), H204 (= H207)
- binding pyruvic acid: Q15 (= Q18), G47 (= G50), L80 (= L83), R82 (= R85), T337 (= T340)
2nx9B Crystal structure of the carboxyltransferase domain of the oxaloacetate decarboxylase na+ pump from vibrio cholerae (see paper)
55% identity, 73% coverage: 4:443/599 of query aligns to 5:453/453 of 2nx9B
Q70AC7 Methylmalonyl-CoA carboxyltransferase 5S subunit; Transcarboxylase 5S subunit; EC 2.1.3.1 from Propionibacterium freudenreichii subsp. shermanii (see paper)
54% identity, 74% coverage: 4:446/599 of query aligns to 12:459/505 of Q70AC7
- A59 (= A51) mutation to T: Decreases activity by 96%.
- K184 (= K176) modified: N6-carboxylysine; partial; mutation K->A,E: Loss of activity.
- M186 (= M178) mutation to I: Decreases activity by 98%.
1rqhA Propionibacterium shermanii transcarboxylase 5s subunit bound to pyruvic acid (see paper)
54% identity, 74% coverage: 4:446/599 of query aligns to 9:456/471 of 1rqhA
- active site: D20 (= D15), D124 (= D119), K181 (= K176), H212 (= H205), H214 (= H207), T346 (= T340)
- binding cobalt (ii) ion: D20 (= D15), K181 (= K176), H212 (= H205), H214 (= H207)
- binding pyruvic acid: Q23 (= Q18), G55 (= G50), L88 (= L83), K181 (= K176)
1rr2A Propionibacterium shermanii transcarboxylase 5s subunit bound to 2- ketobutyric acid (see paper)
54% identity, 74% coverage: 4:446/599 of query aligns to 10:457/472 of 1rr2A
- active site: D21 (= D15), D125 (= D119), K182 (= K176), H213 (= H205), H215 (= H207), T347 (= T340)
- binding 2-ketobutyric acid: Q24 (= Q18), G56 (= G50), L89 (= L83), K182 (= K176)
- binding cobalt (ii) ion: D21 (= D15), K182 (= K176), H213 (= H205), H215 (= H207)
1rqeA Propionibacterium shermanii transcarboxylase 5s subunit bound to oxaloacetate (see paper)
54% identity, 74% coverage: 4:446/599 of query aligns to 10:457/472 of 1rqeA
1rqbA Propionibacterium shermanii transcarboxylase 5s subunit (see paper)
54% identity, 74% coverage: 4:446/599 of query aligns to 10:457/472 of 1rqbA
5ks8F Crystal structure of two-subunit pyruvate carboxylase from methylobacillus flagellatus (see paper)
63% identity, 48% coverage: 5:291/599 of query aligns to 1:281/482 of 5ks8F
4qshC Crystal structure of l. Monocytogenes pyruvate carboxylase in complex with cyclic-di-amp (see paper)
34% identity, 100% coverage: 3:599/599 of query aligns to 469:1080/1081 of 4qshC
- active site: K650 (= K176)
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: Y662 (≠ A188), Y689 (≠ M215), A693 (= A219), S696 (≠ E222)
- binding manganese (ii) ion: D481 (= D15), H679 (= H205), H681 (= H207)
4hnvB Crystal structure of r54e mutant of s. Aureus pyruvate carboxylase (see paper)
35% identity, 99% coverage: 8:599/599 of query aligns to 422:1033/1033 of 4hnvB
- active site: D429 (= D15), D535 (= D119), K599 (= K176), H628 (= H205), H630 (= H207), I651 (= I228), S657 (≠ A234), M658 (≠ F235), T697 (≠ E274), T763 (= T340), S765 (≠ T342), V777 (= V354), N779 (≠ A356), Q784 (≠ E361)
- binding 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal: F475 (= F59), K477 (= K61)
- binding manganese (ii) ion: D429 (= D15), K599 (= K176), H628 (= H205), H630 (= H207)
Sites not aligning to the query:
- active site: 117, 139, 165, 204, 206, 218, 220, 222, 226, 274
- binding 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal: 362, 368, 369
3bg5A Crystal structure of staphylococcus aureus pyruvate carboxylase (see paper)
35% identity, 99% coverage: 8:599/599 of query aligns to 526:1137/1137 of 3bg5A
- active site: D533 (= D15), D639 (= D119), K703 (= K176), H732 (= H205), H734 (= H207), I755 (= I228), S761 (≠ A234), M762 (≠ F235), T801 (≠ E274), T867 (= T340), S869 (≠ T342), V881 (= V354), N883 (≠ A356), Q888 (≠ E361)
- binding 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal: F579 (= F59)
- binding manganese (ii) ion: D533 (= D15), H732 (= H205), H734 (= H207)
- binding pyruvic acid: L603 (= L83), K703 (= K176)
Sites not aligning to the query:
- active site: 117, 159, 189, 202, 228, 267, 269, 281, 283, 285, 289, 337
- binding adenosine-5'-triphosphate: 117, 157, 159, 196, 197, 202, 226, 229, 269, 271, 281, 283
- binding 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal: 463, 471, 472, 473
3bg5B Crystal structure of staphylococcus aureus pyruvate carboxylase (see paper)
35% identity, 99% coverage: 8:599/599 of query aligns to 463:1074/1074 of 3bg5B
- active site: D470 (= D15), D576 (= D119), K640 (= K176), H669 (= H205), H671 (= H207), I692 (= I228), S698 (≠ A234), M699 (≠ F235), T738 (≠ E274), T804 (= T340), S806 (≠ T342), V818 (= V354), N820 (≠ A356), Q825 (≠ E361)
- binding 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal: F516 (= F59), K518 (= K61)
- binding manganese (ii) ion: D470 (= D15), H669 (= H205), H671 (= H207)
- binding pyruvic acid: Q473 (= Q18), K640 (= K176), T804 (= T340)
Sites not aligning to the query:
- active site: 117, 139, 165, 204, 206, 218, 220, 222, 226, 274
- binding 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal: 403, 408, 409, 410
A0A0H3JRU9 Pyruvate carboxylase; EC 6.4.1.1 from Staphylococcus aureus (strain Mu50 / ATCC 700699) (see 2 papers)
35% identity, 99% coverage: 6:599/599 of query aligns to 533:1146/1150 of A0A0H3JRU9
- RDAHQ 541:545 (= RDAHQ 14:18) binding
- D542 (= D15) binding
- A580 (= A51) mutation to T: Complete loss of catalytic activity.
- R614 (= R85) mutation to A: Complete loss of catalytic activity.
- Y621 (= Y92) mutation to A: Complete loss of catalytic activity.
- K712 (= K176) binding
- H741 (= H205) binding
- H743 (= H207) binding
- Q838 (≠ M302) mutation to A: About 2.5-fold loss of catalytic activity.
- T876 (= T340) mutation to A: Complete loss of catalytic activity.
- S879 (= S343) mutation to A: About 2-fold loss of catalytic activity.
- K880 (≠ Q344) mutation to T: Complete loss of catalytic activity.
Sites not aligning to the query:
- 21 R→A: Complete loss of catalytic activity.
- 119 binding
- 161 binding
- 211 binding
- 278 binding
- 411 K→A: Complete loss of catalytic activity.
3hb9A Crystal structure of s. Aureus pyruvate carboxylase a610t mutant (see paper)
35% identity, 99% coverage: 8:599/599 of query aligns to 522:1133/1133 of 3hb9A
- active site: D529 (= D15), D635 (= D119), K699 (= K176), H728 (= H205), H730 (= H207), I751 (= I228), S757 (≠ A234), M758 (≠ F235), T797 (≠ E274), T863 (= T340), S865 (≠ T342), V877 (= V354), N879 (≠ A356), Q884 (≠ E361)
- binding 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal: F575 (= F59), K577 (= K61)
- binding manganese (ii) ion: D529 (= D15), H728 (= H205), H730 (= H207)
Sites not aligning to the query:
- active site: 117, 159, 198, 224, 263, 265, 277, 279, 281, 285, 333
- binding adenosine-5'-diphosphate: 117, 157, 192, 193, 198, 222, 225, 267, 276, 277
- binding 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal: 459, 462, 467, 468
5vyzC Crystal structure of lactococcus lactis pyruvate carboxylase in complex with cyclic-di-amp (see paper)
34% identity, 99% coverage: 4:599/599 of query aligns to 469:1083/1083 of 5vyzC
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: P657 (= P184), Y661 (≠ A188), S691 (≠ W218), Q695 (≠ E222)
- binding manganese (ii) ion: D480 (= D15), K649 (= K176), H678 (= H205), H680 (= H207)
Sites not aligning to the query:
7zz3A Cryo-em structure of "bc react" conformation of lactococcus lactis pyruvate carboxylase with acetyl-coa (see paper)
33% identity, 99% coverage: 4:599/599 of query aligns to 524:1138/1138 of 7zz3A
- binding acetyl coenzyme *a: K1016 (≠ E476), T1017 (≠ S477), L1018 (≠ Y478), R1045 (≠ E504)
- binding biotin: K1104 (= K565)
- binding magnesium ion: D754 (= D226)
- binding manganese (ii) ion: D535 (= D15), K704 (= K176), H733 (= H205), H735 (= H207)
- binding pyruvic acid: R534 (= R14), Q538 (= Q18), L605 (= L83), K704 (= K176), T868 (= T340)
Sites not aligning to the query:
- binding acetyl coenzyme *a: 22, 43, 44, 45, 46, 48, 363, 413, 414, 416, 418, 459, 461
- binding adenosine-5'-triphosphate: 117, 156, 158, 163, 164, 165, 168, 200, 202, 203, 208, 232, 235, 277, 287, 289, 443
- binding bicarbonate ion: 237, 291, 293, 295
- binding biotin: 84, 294, 342
- binding magnesium ion: 275, 287, 520, 523
5vyzA Crystal structure of lactococcus lactis pyruvate carboxylase in complex with cyclic-di-amp (see paper)
33% identity, 99% coverage: 4:599/599 of query aligns to 530:1144/1144 of 5vyzA
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: Q719 (≠ A185), Y722 (≠ A188), S752 (≠ W218), G753 (≠ A219), Q756 (≠ E222)
- binding manganese (ii) ion: D541 (= D15), K710 (= K176), H739 (= H205), H741 (= H207)
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 123, 162, 164, 168, 170, 171, 174, 208, 209, 214, 238, 241, 283, 293, 449
- binding magnesium ion: 281, 293
3tw6B Structure of rhizobium etli pyruvate carboxylase t882a with the allosteric activator, acetyl coenzyme-a (see paper)
34% identity, 98% coverage: 2:589/599 of query aligns to 531:1123/1129 of 3tw6B
- active site: D544 (= D15), D650 (= D119), K713 (= K176), H742 (= H205), H744 (= H207), A877 (≠ T340)
- binding 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal: K1102 (= K565)
- binding magnesium ion: E532 (≠ K3), D763 (= D226)
- binding zinc ion: D544 (= D15), K713 (= K176), H742 (= H205), H744 (= H207)
Sites not aligning to the query:
- active site: 124, 162, 212, 238, 277, 279, 293, 295, 297, 301, 349
- binding adenosine-5'-diphosphate: 124, 162, 167, 169, 172, 204, 206, 207, 212, 236, 239, 281, 293, 450
- binding 5-(hexahydro-2-oxo-1h-thieno[3,4-d]imidazol-6-yl)pentanal: 349, 395
- binding magnesium ion: 279, 293, 529, 530
2qf7A Crystal structure of a complete multifunctional pyruvate carboxylase from rhizobium etli (see paper)
34% identity, 98% coverage: 2:589/599 of query aligns to 466:1067/1076 of 2qf7A
- active site: D479 (= D15), D585 (= D119), K648 (= K176), H677 (= H205), H679 (= H207), T812 (= T340)
- binding coenzyme a: I956 (≠ V473), K960 (≠ S477), L962 (≠ D479), N985 (≠ D500)
- binding magnesium ion: E467 (≠ K3), D698 (= D226)
- binding zinc ion: D479 (= D15), K648 (= K176), H677 (= H205), H679 (= H207)
Sites not aligning to the query:
- active site: 124, 147, 173, 212, 214, 228, 230, 232, 236, 284
- binding phosphothiophosphoric acid-adenylate ester: 147, 171, 214, 216, 228, 385
- binding coenzyme a: 400, 401, 402, 403, 404
- binding magnesium ion: 214, 228, 464, 465
Query Sequence
>GFF3995 FitnessBrowser__Marino:GFF3995
MTKRKIHITDVILRDAHQSLIATRMRTEDMLPACEWLDQAGYWSLECWGGATFDACVRFL
KEDPWERLRTLRKALPNTRLQMLLRGQNLLGYRHYGDDVVEAFVAKAAENGMDVFRIFDA
LNDVRNLETSIKAVKKAGKHAQGTICYTVSPVHGTDAYLEQAKAMADMGADSIAIKDMAG
LLTPAVTAELVGKLKQTLNLPVFLHSHATSGMAPMCQWAAMEAGVDHIDTALSAFAGGTS
HPPTESLVAALHDAGLETGLNLELLDKATRHFREVRKKYHQFESAYNGVDTSVLLSQVPG
GMMSNLANQLKEQGALDRIQDVFEEIPRVRKDLGYPPLVTPTSQIVGTQAVINVLAGKRY
ESITNEVKKYLQGWYGKAPAAVDKSLQQRAVGKEDLIEERPANLIPRELDELRKQVGELA
TSEEDVLTYAMFPDQAKAYLEQRRDGTLQPEPLEPIPTGSSGGSVSSKFKITVHGESYDI
HVTGANPSGENERRFYMTVDGVPEEIHLASLGEDGEGARSSGGRATATKEGHVTTSMPGN
IVDVLVKEGDEVQAGDPVLIIEAMKMETEVKATTAGKVSGVFIAKGDRVVPGEVLVEID
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory