SitesBLAST
Comparing GFF3998 FitnessBrowser__Marino:GFF3998 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7jqhA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with phosphate and NADP+
42% identity, 100% coverage: 1:309/309 of query aligns to 2:313/313 of 7jqhA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A66 (= A67), R90 (= R86), M100 (= M96), A145 (≠ L141), G146 (= G142), V147 (≠ H143), L148 (≠ I144), W166 (= W162), S167 (≠ A163), R168 (= R164), T169 (≠ G165), K171 (≠ H167), L199 (= L195), P200 (= P196), L226 (≠ V222), A227 (≠ G223), R228 (= R224), D252 (= D248), H276 (= H272), A279 (= A275), Y313 (= Y309)
7jqiA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with alpha-ketoglutarate and NADP+
42% identity, 100% coverage: 1:309/309 of query aligns to 1:312/312 of 7jqiA
- binding 2-oxoglutaric acid: G64 (= G66), A65 (= A67), G66 (= G68), R227 (= R224), H275 (= H272)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A65 (= A67), R89 (= R86), M99 (= M96), A144 (≠ L141), G145 (= G142), V146 (≠ H143), L147 (≠ I144), W165 (= W162), S166 (≠ A163), R167 (= R164), T168 (≠ G165), K170 (≠ H167), L198 (= L195), P199 (= P196), L225 (≠ V222), R227 (= R224), H275 (= H272), A278 (= A275), Y312 (= Y309)
6p35A 2.5 angstrom structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with 2-keto arginine and NADP
42% identity, 100% coverage: 1:309/309 of query aligns to 1:312/312 of 6p35A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A65 (= A67), R89 (= R86), M99 (= M96), A144 (≠ L141), G145 (= G142), V146 (≠ H143), L147 (≠ I144), W165 (= W162), S166 (≠ A163), R167 (= R164), T168 (≠ G165), K170 (≠ H167), L198 (= L195), P199 (= P196), L225 (≠ V222), R227 (= R224), H275 (= H272), A277 (≠ S274), A278 (= A275), Y312 (= Y309)
- binding 5-[(diaminomethylidene)amino]-2-oxopentanoic acid: F10 (≠ P10), D11 (≠ K11), W15 (= W15), A65 (= A67), R227 (= R224), H275 (= H272), T280 (= T277)
3kboA 2.14 angstrom crystal structure of putative oxidoreductase (ycdw) from salmonella typhimurium in complex with NADP
41% identity, 100% coverage: 1:309/309 of query aligns to 1:312/312 of 3kboA
- active site: M95 (= M92), R227 (= R224), E256 (= E253), H275 (= H272)
- binding N-(2-hydroxyethyl)-N,N-dimethyl-3-sulfopropan-1-aminium: N36 (≠ A37), A53 (≠ E54), R55 (≠ K57), R56 (≠ H58)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R89 (= R86), M99 (= M96), G143 (= G140), A144 (≠ L141), G145 (= G142), V146 (≠ H143), L147 (≠ I144), W165 (= W162), S166 (≠ A163), R167 (= R164), S168 (≠ G165), K170 (≠ H167), L197 (≠ T194), P199 (= P196), L225 (≠ V222), A226 (≠ G223), R227 (= R224), D251 (= D248), H275 (= H272), A278 (= A275), Y312 (= Y309)
5vg6B Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from xanthobacter autotrophicus py2 in complex with NADPH and mes.
40% identity, 89% coverage: 34:309/309 of query aligns to 41:315/315 of 5vg6B
- active site: M98 (= M92), R230 (= R224), D254 (= D248), E259 (= E253), H278 (= H272)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A74 (= A67), R92 (= R86), M102 (= M96), L147 (= L141), G148 (= G142), D149 (≠ H143), L150 (≠ I144), W168 (= W162), S169 (≠ A163), R170 (= R164), T171 (≠ G165), K173 (≠ H167), L201 (= L195), P202 (= P196), T207 (= T201), V228 (= V222), R230 (= R224), H278 (= H272), A280 (≠ S274), S281 (≠ A275), Y315 (= Y309)
4z0pA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
37% identity, 87% coverage: 41:309/309 of query aligns to 45:316/316 of 4z0pA
- active site: L95 (≠ M92), R231 (= R224), G250 (≠ L243), D255 (= D248), E260 (= E253), H279 (= H272)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R89 (= R86), M99 (= M96), M144 (≠ L141), G145 (= G142), V146 (≠ H143), L147 (≠ I144), W165 (= W162), S166 (≠ A163), R167 (= R164), S168 (≠ G165), R170 (≠ H167), L197 (= L195), P198 (= P196), A229 (≠ V222), G230 (= G223), R231 (= R224), H279 (= H272), A281 (≠ S274), A282 (= A275), Y316 (= Y309)
- binding oxalic acid: W50 (= W46), G70 (= G66), A71 (= A67), G72 (= G68), H114 (≠ M111), R115 (≠ E112), R231 (= R224), H279 (= H272)
4weqA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADP and sulfate (see paper)
37% identity, 87% coverage: 41:309/309 of query aligns to 45:316/316 of 4weqA
- active site: L95 (≠ M92), R231 (= R224), G250 (≠ L243), D255 (= D248), E260 (= E253), H279 (= H272)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R89 (= R86), M99 (= M96), M144 (≠ L141), G145 (= G142), V146 (≠ H143), L147 (≠ I144), W165 (= W162), S166 (≠ A163), R167 (= R164), S168 (≠ G165), R170 (≠ H167), L197 (= L195), P198 (= P196), A229 (≠ V222), G230 (= G223), R231 (= R224), D255 (= D248), H279 (= H272), A281 (≠ S274), Y316 (= Y309)
5bqfA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADP, hepes and l(+)-tartaric acid
36% identity, 88% coverage: 39:309/309 of query aligns to 44:317/317 of 5bqfA
- active site: E261 (= E253), H280 (= H272)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A72 (= A67), R90 (= R86), M100 (= M96), G144 (= G140), L145 (= L141), G146 (= G142), I147 (≠ H143), L148 (≠ I144), W166 (= W162), S167 (≠ A163), R168 (= R164), T169 (≠ G165), L198 (= L195), P199 (= P196), A230 (≠ V222), G231 (= G223), R232 (= R224), H280 (= H272), A283 (= A275), Y317 (= Y309)
4xcvA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADPH
36% identity, 88% coverage: 39:309/309 of query aligns to 44:317/317 of 4xcvA
- active site: E261 (= E253), H280 (= H272)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A72 (= A67), R90 (= R86), M100 (= M96), G144 (= G140), L145 (= L141), G146 (= G142), I147 (≠ H143), L148 (≠ I144), W166 (= W162), S167 (≠ A163), R168 (= R164), T169 (≠ G165), K171 (≠ H167), L198 (= L195), P199 (= P196), A230 (≠ V222), G231 (= G223), R232 (= R224), H280 (= H272), A283 (= A275), Y317 (= Y309)
5tsdA Crystal structure of NADPH-dependent 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADPH and oxalate
36% identity, 88% coverage: 39:309/309 of query aligns to 43:316/316 of 5tsdA
- active site: E260 (= E253), H279 (= H272)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A71 (= A67), R89 (= R86), M99 (= M96), G143 (= G140), L144 (= L141), G145 (= G142), I146 (≠ H143), L147 (≠ I144), W165 (= W162), S166 (≠ A163), R167 (= R164), T168 (≠ G165), K170 (≠ H167), L197 (= L195), P198 (= P196), A229 (≠ V222), G230 (= G223), R231 (= R224), D255 (= D248), H279 (= H272), Y316 (= Y309)
- binding oxalic acid: W50 (= W46), G70 (= G66), A71 (= A67), G72 (= G68), R231 (= R224), H279 (= H272)
4zqbB Crystal structure of NADP-dependent dehydrogenase from rhodobactersphaeroides in complex with NADP and sulfate
36% identity, 95% coverage: 15:309/309 of query aligns to 21:316/316 of 4zqbB
- active site: L99 (≠ M92), R231 (= R224), E260 (= E253), H279 (= H272)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R93 (= R86), M103 (= M96), G147 (= G140), L148 (= L141), G149 (= G142), E150 (≠ H143), L151 (≠ I144), W169 (= W162), S170 (≠ A163), R171 (= R164), S172 (≠ G165), K174 (≠ H167), L202 (= L195), P203 (= P196), F229 (≠ V222), R231 (= R224), H279 (= H272), S281 (= S274), A282 (= A275), Y316 (= Y309)
5mh6A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-ketohexanoic acid and NAD+ (1.35 a resolution)
35% identity, 66% coverage: 96:298/309 of query aligns to 93:296/306 of 5mh6A
- binding 2-Ketohexanoic acid: R224 (= R224), H272 (= H272), Y280 (≠ T282)
- binding magnesium ion: T130 (≠ K130), A132 (≠ S132), F210 (≠ L210), E211 (≠ S211), M213 (≠ L213), G225 (= G225), P226 (≠ E226), V228 (≠ L228), E230 (= E230), D241 (≠ T241), S251 (≠ R251)
- binding nicotinamide-adenine-dinucleotide: G142 (= G142), T143 (≠ H143), L144 (≠ I144), R164 (= R164), P196 (= P196), T201 (= T201), V222 (= V222), A223 (≠ G223), R224 (= R224), H272 (= H272), S274 (= S274)
Sites not aligning to the query:
5mhaB D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
35% identity, 66% coverage: 96:298/309 of query aligns to 95:298/308 of 5mhaB
- binding 2-Ketohexanoic acid: R226 (= R224), H274 (= H272), Y282 (≠ T282)
- binding (2R)-2-hydroxyhexanoic acid: Y282 (≠ T282)
- binding magnesium ion: F212 (≠ L210), E213 (≠ S211), M215 (≠ L213), D243 (≠ T241)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L143 (= L141), G144 (= G142), T145 (≠ H143), L146 (≠ I144), R165 (≠ A163), R166 (= R164), S167 (≠ G165), P180 (= P178), T197 (≠ L195), P198 (= P196), T203 (= T201), V224 (= V222), A225 (≠ G223), R226 (= R224), H274 (= H272), S276 (= S274)
Sites not aligning to the query:
5mhaA D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
35% identity, 66% coverage: 96:298/309 of query aligns to 95:298/308 of 5mhaA
- binding 2-Ketohexanoic acid: R226 (= R224), H274 (= H272), Y282 (≠ T282)
- binding magnesium ion: T132 (≠ K130), A134 (≠ S132)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L143 (= L141), G144 (= G142), T145 (≠ H143), L146 (≠ I144), R165 (≠ A163), R166 (= R164), S167 (≠ G165), P180 (= P178), T197 (≠ L195), P198 (= P196), T203 (= T201), V224 (= V222), A225 (≠ G223), R226 (= R224), H274 (= H272), S276 (= S274)
Sites not aligning to the query:
5mh5A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-keto-hexanoic acid and NADP+ (1.4 a resolution)
35% identity, 66% coverage: 96:298/309 of query aligns to 95:298/308 of 5mh5A
- binding 2-Ketohexanoic acid: R226 (= R224), H274 (= H272), Y282 (≠ T282)
- binding magnesium ion: T132 (≠ K130), A134 (≠ S132), F212 (≠ L210), E213 (≠ S211), M215 (≠ L213), D243 (≠ T241)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G142 (= G140), L143 (= L141), G144 (= G142), T145 (≠ H143), L146 (≠ I144), R165 (≠ A163), R166 (= R164), S167 (≠ G165), T197 (≠ L195), P198 (= P196), T203 (= T201), V224 (= V222), A225 (≠ G223), R226 (= R224), H274 (= H272), S276 (= S274)
Sites not aligning to the query:
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
31% identity, 72% coverage: 73:296/309 of query aligns to 91:305/313 of Q65CJ7
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
31% identity, 72% coverage: 73:296/309 of query aligns to 89:303/311 of 3bazA
- active site: L98 (= L82), R230 (= R224), A251 (= A245), D254 (= D248), E259 (= E253), H277 (= H272)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G149 (= G140), L150 (= L141), G151 (= G142), R152 (≠ H143), I153 (= I144), S172 (≠ A163), R173 (= R164), S174 (≠ G165), C201 (≠ L195), P202 (= P196), T207 (= T201), I228 (≠ V222), G229 (= G223), R230 (= R224), D254 (= D248), H277 (= H272), G279 (≠ S274)
Sites not aligning to the query:
6t9wB Crystal structure of formate dehydrogenase fdh2 d222a/q223r enzyme from granulicella mallensis mp5actx8 in complex with NADP and azide.
27% identity, 83% coverage: 23:278/309 of query aligns to 87:338/383 of 6t9wB
- binding azide ion: P97 (= P33), F98 (≠ E34), G121 (= G66), I122 (≠ A67), H332 (= H272)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I122 (≠ A67), N146 (≠ G91), S147 (= S93), V150 (≠ M96), A198 (≠ G140), G200 (= G142), R201 (≠ H143), I202 (= I144), F220 (≠ W162), R222 (= R164), P256 (= P196), H258 (≠ T198), T261 (= T201), T282 (≠ V222), A283 (≠ G223), R284 (= R224), D308 (= D248), H332 (= H272), S334 (= S274), G335 (≠ A275)
Sites not aligning to the query:
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
28% identity, 72% coverage: 58:279/309 of query aligns to 74:300/328 of Q9UBQ7
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
28% identity, 72% coverage: 58:279/309 of query aligns to 70:296/324 of 2gcgA
- active site: L103 (= L82), R241 (= R224), D265 (= D248), E270 (= E253), H289 (= H272)
- binding (2r)-2,3-dihydroxypropanoic acid: S78 (≠ G66), V79 (≠ A67), G80 (= G68), R241 (= R224), H289 (= H272)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V79 (≠ A67), T107 (≠ M96), G156 (= G140), G158 (= G142), I160 (= I144), G180 (vs. gap), R181 (vs. gap), R184 (= R164), C212 (≠ L195), S213 (≠ P196), T218 (= T201), I239 (≠ V222), R241 (= R224), D265 (= D248), H289 (= H272), G291 (≠ S274)
Sites not aligning to the query:
Query Sequence
>GFF3998 FitnessBrowser__Marino:GFF3998
MKILFVAGDPKPERWTVPIKELLPEAKVYVWDPEGPAVDADYAIVWQPPEALFEREKHLK
AVFNLGAGIDGLLKVANLPEALTVVRLEDAGMSVQMAEYVLHQLLEASREMETYREQQRQ
GVWKIHRPIKRSEWPVGVMGLGHIGKRVASTLANLDYRVSGWARGEHSLEGVSTYAGPDE
LGDFLKATRVLVNTLPLTDNTRNIIDYELLSQLQPGAVLINVGRGEHLVEDDLLRALDDG
TLLRASLDVFRKEPLPEGHPFWQRKEITITPHISARTLRDATIEQITGKIRDHAQGLAIT
GIVDTERGY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory