Comparing GFF4001 FitnessBrowser__psRCH2:GFF4001 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6wngA Crystal structure of an aspartate ammonia-lyase from elizabethkingia anophelis nuhp1
60% identity, 97% coverage: 8:467/474 of query aligns to 4:462/466 of 6wngA
3oceA Crystal structure of fumarate lyase:delta crystallin from brucella melitensis bound to cobalt
59% identity, 97% coverage: 7:467/474 of query aligns to 2:460/461 of 3oceA
P0AC38 Aspartate ammonia-lyase; Aspartase; EC 4.3.1.1 from Escherichia coli (strain K12) (see 2 papers)
55% identity, 97% coverage: 8:467/474 of query aligns to 6:465/478 of P0AC38
3r6qA A triclinic-lattice structure of aspartase from bacillus sp. Ym55-1 (see paper)
50% identity, 98% coverage: 8:470/474 of query aligns to 2:461/462 of 3r6qA
3r6vG Crystal structure of aspartase from bacillus sp. Ym55-1 with bound l- aspartate (see paper)
50% identity, 98% coverage: 8:470/474 of query aligns to 3:462/463 of 3r6vG
P05042 Fumarate hydratase class II; Fumarase C; Aerobic fumarase; Iron-independent fumarase; EC 4.2.1.2 from Escherichia coli (strain K12) (see 4 papers)
41% identity, 97% coverage: 8:465/474 of query aligns to 5:460/467 of P05042
1fuqA Fumarase with bound 3-trimethylsilylsuccinic acid (see paper)
42% identity, 96% coverage: 8:464/474 of query aligns to 2:456/456 of 1fuqA
1fuoA FumarasE C with bound citrate (see paper)
42% identity, 96% coverage: 8:464/474 of query aligns to 2:456/456 of 1fuoA
1fupA Fumarase with bound pyromellitic acid (see paper)
42% identity, 96% coverage: 8:464/474 of query aligns to 1:455/455 of 1fupA
Q9ZCQ4 Fumarate hydratase class II; Fumarase C; Aerobic fumarase; Iron-independent fumarase; EC 4.2.1.2 from Rickettsia prowazekii (strain Madrid E) (see paper)
39% identity, 97% coverage: 8:466/474 of query aligns to 5:461/461 of Q9ZCQ4
P08417 Fumarate hydratase, mitochondrial; Fumarase; EC 4.2.1.2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
40% identity, 98% coverage: 5:468/474 of query aligns to 26:488/488 of P08417
Sites not aligning to the query:
P07954 Fumarate hydratase, mitochondrial; Fumarase; HsFH; EC 4.2.1.2 from Homo sapiens (Human) (see 4 papers)
39% identity, 99% coverage: 1:468/474 of query aligns to 44:510/510 of P07954
Sites not aligning to the query:
7lubB Crystal structure of recombinant human fumarase in complex with d-2- amino-3-phosphono-propionic acid (see paper)
39% identity, 98% coverage: 6:468/474 of query aligns to 1:462/462 of 7lubB
7c18B Crystal structure of fumarasec from mannheimia succiniciproducens in complex with fumarate
39% identity, 97% coverage: 8:465/474 of query aligns to 4:460/464 of 7c18B
P9WN93 Fumarate hydratase class II; Fumarase C; Aerobic fumarase; Iron-independent fumarase; EC 4.2.1.2 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
42% identity, 97% coverage: 2:459/474 of query aligns to 5:454/474 of P9WN93
4adlA Crystal structures of rv1098c in complex with malate (see paper)
42% identity, 95% coverage: 8:459/474 of query aligns to 3:446/459 of 4adlA
4apbD Crystal structure of mycobacterium tuberculosis fumarase (rv1098c) s318c in complex with fumarate (see paper)
42% identity, 95% coverage: 8:459/474 of query aligns to 3:446/462 of 4apbD
6s7uA Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator n-(5-(azepan-1-ylsulfonyl)-2- methoxyphenyl)-2-(1h-indol-3-yl)acetamide (see paper)
41% identity, 95% coverage: 8:459/474 of query aligns to 2:437/450 of 6s7uA
6s7kA Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator n-(2-methoxy-5-(n-methylsulfamoyl) phenyl)-2-(4-oxo-3,4-dihydrophthalazin-1-yl)acetamide (see paper)
41% identity, 95% coverage: 8:459/474 of query aligns to 2:437/450 of 6s7kA
6s43A Fumarate hydratase of mycobacterium tuberculosis in complex with formate and allosteric modulator n-(5-(azocan-1-ylsulfonyl)-2- methoxyphenyl)-2-(4-oxo-3,4-dihydrophthalazin-1-yl)acetamide (see paper)
41% identity, 95% coverage: 8:459/474 of query aligns to 2:437/450 of 6s43A
>GFF4001 FitnessBrowser__psRCH2:GFF4001
MSEVASSRVEKDLLGTLPVPSDAYYGIQTLRALHNFRLSGVPLSHYPKLIVALAMVKQAA
ADANRELGYLPETKHVAISQGCARLIRGEFHEQFVVDMIQGGAGTSTNMNANEVIANLGL
EAMGHAKGEYQYLHPNNDVNMAQSTNDAYPTAIRLGLLLGHDTLLASLESLCQSLTGKGH
AFAHVLKMGRTQLQDAVPMTLGQEFHAFATTLGEDLQHLRGFAPQLLLEVNLGGTAIGTG
INADPRYQAIAVQRLAQISGQPLRQAADLIEATSDMGSFVLFSGMLKRLAVKLSKICNDL
RLLSSGPRTGFNEINLPPRQPGSSIMPGKVNPVIPEAVNQVAFEVIGNDLALTMAAEGGQ
LQLNVMEPLIAYKLFDSIRLLQRAMDMLREHCIEGITANEDRCRELMESSIGLITALNPY
IGYDNSTRLAREALLGGRSVLELVREERLLDDAMLAEILRPENMIAPRLAPLAV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory