Comparing GFF4002 Psest_4075 Na+/H+-dicarboxylate symporters to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
47% identity, 96% coverage: 12:412/419 of query aligns to 5:423/425 of O59010
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
47% identity, 93% coverage: 16:405/419 of query aligns to 1:408/408 of 6bauA
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
47% identity, 93% coverage: 16:405/419 of query aligns to 1:408/409 of 6bavA
2nwwA Crystal structure of gltph in complex with tboa (see paper)
47% identity, 93% coverage: 18:405/419 of query aligns to 2:407/407 of 2nwwA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
46% identity, 95% coverage: 12:408/419 of query aligns to 5:419/419 of 6x15A
Sites not aligning to the query:
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
47% identity, 94% coverage: 12:405/419 of query aligns to 2:413/413 of 6x14A
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
44% identity, 97% coverage: 11:416/419 of query aligns to 2:427/427 of 5e9sA
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
44% identity, 97% coverage: 11:415/419 of query aligns to 2:426/426 of 6xwnB
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
44% identity, 97% coverage: 12:416/419 of query aligns to 1:425/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
44% identity, 95% coverage: 18:416/419 of query aligns to 6:424/424 of 6zl4A
Sites not aligning to the query:
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
44% identity, 95% coverage: 18:416/419 of query aligns to 2:416/416 of 6r7rA
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
45% identity, 93% coverage: 16:405/419 of query aligns to 1:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
37% identity, 89% coverage: 40:410/419 of query aligns to 49:408/412 of 7awmA
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
36% identity, 88% coverage: 43:409/419 of query aligns to 42:419/424 of 7xr6A
Sites not aligning to the query:
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
36% identity, 88% coverage: 43:409/419 of query aligns to 41:420/425 of 7xr4A
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
35% identity, 86% coverage: 48:409/419 of query aligns to 56:465/503 of Q10901
8cuaA Human excitatory amino acid transporter 3 (eaat3) with bound potassium in an intermediate outward facing state (see paper)
37% identity, 82% coverage: 66:410/419 of query aligns to 61:411/416 of 8cuaA
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
33% identity, 90% coverage: 43:419/419 of query aligns to 77:528/572 of P43006
Sites not aligning to the query:
P31596 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; GLUT-R; Solute carrier family 1 member 2 from Rattus norvegicus (Rat) (see paper)
33% identity, 93% coverage: 29:418/419 of query aligns to 52:508/573 of P31596
8ctcA Human excitatory amino acid transporter 3 (eaat3) with bound glutamate in an intermediate outward facing state (see paper)
38% identity, 82% coverage: 66:408/419 of query aligns to 58:406/406 of 8ctcA
>GFF4002 Psest_4075 Na+/H+-dicarboxylate symporters
MTQSTTLSAPLRLLVRLPLWQQILIGLALGVAAGMAFGADAQLLAPIGTLFLNAIKMLIV
PLVFVSLVAGITSMQDSAKLGRISLKTIAIYLVTTAFAVSIGLLFGALFSPGEGMNMVAS
GNEQAKQAPSLVSILVGLVPANPVTAFAEGNILQIIVFAIALGVSINLIGERGAPAVRLF
DALAETFYKLTDLVMRVAPIGVFALTAGVVGSHGAEVLLPLAGVIGVIYLASIAHVLLVY
GGLLGLLARLNPLRFFQGIAPALAVAFSTSSSSGTLPVSIECARKNLGVSEGVAGFVLPV
GATINMDGTAIYQGVLALFIAQAFGIDLSAGQYAMIILTATLASIGTAGIPGAGLIMLGL
VLTAAGLPLEGVALIAGIDRILDMARTTVNVAGDLMTTTLVGRSEQELDRAIYDSSNKE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory