Comparing GFF4004 FitnessBrowser__Marino:GFF4004 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8h2aA Crystal structure of alcohol dehydrogenase from formosa agariphila
39% identity, 95% coverage: 19:367/368 of query aligns to 18:366/366 of 8h2aA
P80467 Alcohol dehydrogenase class-3; Alcohol dehydrogenase class-III; Glutathione-dependent formaldehyde dehydrogenase; FALDH; FDH; GSH-FDH; S-(hydroxymethyl)glutathione dehydrogenase; EC 1.1.1.1; EC 1.1.1.-; EC 1.1.1.284 from Saara hardwickii (Indian spiny-tailed lizard) (Uromastyx hardwickii) (see paper)
40% identity, 99% coverage: 4:367/368 of query aligns to 6:373/373 of P80467
Sites not aligning to the query:
P25405 Alcohol dehydrogenase 1A; Alcohol dehydrogenase I-A; ADH IA; EC 1.1.1.1 from Saara hardwickii (Indian spiny-tailed lizard) (Uromastyx hardwickii) (see paper)
40% identity, 99% coverage: 4:367/368 of query aligns to 8:375/375 of P25405
Sites not aligning to the query:
P81601 Alcohol dehydrogenase class-3 chain L; Alcohol dehydrogenase class-III chain L; Glutathione-dependent formaldehyde dehydrogenase; FALDH; FDH; GSH-FDH; S-(hydroxymethyl)glutathione dehydrogenase; EC 1.1.1.1; EC 1.1.1.-; EC 1.1.1.284 from Gadus morhua (Atlantic cod) (see 2 papers)
40% identity, 99% coverage: 4:367/368 of query aligns to 8:375/375 of P81601
Sites not aligning to the query:
P80512 Alcohol dehydrogenase 1; EC 1.1.1.1 from Naja naja (Indian cobra) (see paper)
39% identity, 99% coverage: 4:367/368 of query aligns to 8:375/375 of P80512
Sites not aligning to the query:
P80338 Alcohol dehydrogenase 1; Alcohol dehydrogenase I; EC 1.1.1.1 from Struthio camelus (Common ostrich) (see 2 papers)
39% identity, 99% coverage: 4:367/368 of query aligns to 8:374/374 of P80338
Sites not aligning to the query:
P80468 All-trans-retinol dehydrogenase [NAD(+)] ADH4; Alcohol dehydrogenase 4; Alcohol dehydrogenase class II; EC 1.1.1.105 from Struthio camelus (Common ostrich) (see 2 papers)
37% identity, 99% coverage: 4:367/368 of query aligns to 8:379/379 of P80468
Sites not aligning to the query:
P19631 Alcohol dehydrogenase 1; ADH3; Alcohol dehydrogenase subunit alpha; EC 1.1.1.1 from Coturnix japonica (Japanese quail) (Coturnix coturnix japonica) (see paper)
39% identity, 99% coverage: 4:367/368 of query aligns to 8:375/375 of P19631
Sites not aligning to the query:
P81600 Alcohol dehydrogenase class-3 chain H; Alcohol dehydrogenase class-III chain H; Glutathione-dependent formaldehyde dehydrogenase; FALDH; FDH; GSH-FDH; S-(hydroxymethyl)glutathione dehydrogenase; EC 1.1.1.1; EC 1.1.1.-; EC 1.1.1.284 from Gadus morhua (Atlantic cod) (see 2 papers)
38% identity, 99% coverage: 4:367/368 of query aligns to 8:375/375 of P81600
Sites not aligning to the query:
P25406 Alcohol dehydrogenase 1B; Alcohol dehydrogenase I-B; ADH IB; EC 1.1.1.1 from Saara hardwickii (Indian spiny-tailed lizard) (Uromastyx hardwickii) (see paper)
38% identity, 99% coverage: 4:367/368 of query aligns to 8:375/375 of P25406
Sites not aligning to the query:
P23991 Alcohol dehydrogenase 1; ADH-1; Alcohol dehydrogenase I; EC 1.1.1.1 from Gallus gallus (Chicken) (see paper)
38% identity, 99% coverage: 4:367/368 of query aligns to 9:376/376 of P23991
Sites not aligning to the query:
P49645 Alcohol dehydrogenase 1; Alcohol dehydrogenase I; EC 1.1.1.1 from Apteryx australis (Southern brown kiwi) (see paper)
39% identity, 99% coverage: 4:367/368 of query aligns to 9:375/375 of P49645
Sites not aligning to the query:
P80360 Alcohol dehydrogenase class-3; Alcohol dehydrogenase class-III; Glutathione-dependent formaldehyde dehydrogenase; FALDH; FDH; GSH-FDH; S-(hydroxymethyl)glutathione dehydrogenase; EC 1.1.1.1; EC 1.1.1.-; EC 1.1.1.284 from Myxine glutinosa (Atlantic hagfish) (see 2 papers)
40% identity, 99% coverage: 1:365/368 of query aligns to 3:374/376 of P80360
Sites not aligning to the query:
8h2bD Crystal structure of alcohol dehydrogenase from zobellia galactanivorans
38% identity, 99% coverage: 4:367/368 of query aligns to 3:370/370 of 8h2bD
P80222 Alcohol dehydrogenase 1; Alcohol dehydrogenase, major; EC 1.1.1.1 from Alligator mississippiensis (American alligator) (see paper)
37% identity, 99% coverage: 4:367/368 of query aligns to 8:374/374 of P80222
Sites not aligning to the query:
8gv3A The cryo-em structure of gsnor with nyy001
39% identity, 99% coverage: 4:368/368 of query aligns to 5:373/373 of 8gv3A
P19854 Alcohol dehydrogenase class-3; Alcohol dehydrogenase 5; Alcohol dehydrogenase class-III; Glutathione-dependent formaldehyde dehydrogenase; FALDH; FDH; GSH-FDH; S-(hydroxymethyl)glutathione dehydrogenase; EC 1.1.1.1; EC 1.1.1.-; EC 1.1.1.284 from Equus caballus (Horse) (see 2 papers)
38% identity, 98% coverage: 4:365/368 of query aligns to 7:372/374 of P19854
Sites not aligning to the query:
3qj5A S-nitrosoglutathione reductase (gsnor) in complex with n6022 (see paper)
39% identity, 98% coverage: 4:365/368 of query aligns to 5:370/372 of 3qj5A
2fzeA Crystal structure of the binary complex of human glutathione-dependent formaldehyde dehydrogenase with adp-ribose (see paper)
39% identity, 98% coverage: 4:365/368 of query aligns to 6:371/373 of 2fzeA
1mc5A Ternary complex of human glutathione-dependent formaldehyde dehydrogenase with s-(hydroxymethyl)glutathione and nadh (see paper)
39% identity, 98% coverage: 4:365/368 of query aligns to 6:371/373 of 1mc5A
>GFF4004 FitnessBrowser__Marino:GFF4004
MDRQAKAVVCREWGQPVQVETITVEGPKRDEITIKIAACGVCHSDLSATTGKIPYPPPLV
LGHEAAGVVVEVGEGVTAFKEGDHVVSTFISMCGKCSQCVRGRPVLCENARKAMFNLPDG
TVRTKGADGEPLNVFGACGVMAEFATMHVDNCVKVDETVPMQNAALVGCAVMTGVGAVFN
TAKLEPGSRAAVFGIGGVGLNAIQGCVTAGAEMVVAVDSNPAKLAMAKEFGATHTVNINE
VEDAAKAVKKMTGGVDYAFECVGAGPVVEQAYKSLGRGGTAVVVGVADPKDKTSLTTLTL
PADERTLKGSWLGSARPQHDFPRILGLYKAGKLKLDELVTRTYPIEEAAQAFDDMVAGKN
ARGVIVFE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory