Comparing GFF4005 FitnessBrowser__psRCH2:GFF4005 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A962 L-asparaginase 1; L-asparaginase I; L-ASNase I; L-asparagine amidohydrolase I; EC 3.5.1.1 from Escherichia coli (strain K12) (see paper)
36% identity, 98% coverage: 6:326/327 of query aligns to 4:335/338 of P0A962
6nxcB Ecai(t162a) mutant in complex with citrate at ph 4 (see paper)
35% identity, 98% coverage: 6:326/327 of query aligns to 11:334/336 of 6nxcB
2himA Crystal structure and allosteric regulation of the cytoplasmic escherichia coli l-asparaginase i (see paper)
34% identity, 98% coverage: 6:326/327 of query aligns to 2:323/324 of 2himA
7r6bB Crystal structure of mutant r43d/l124d/r125a/c273s of l-asparaginase i from yersinia pestis (see paper)
33% identity, 98% coverage: 6:327/327 of query aligns to 2:301/301 of 7r6bB
4r8lA Crystal structure of the asp-bound guinea pig l-asparaginase 1 catalytic domain (see paper)
34% identity, 98% coverage: 6:326/327 of query aligns to 2:352/354 of 4r8lA
5dndD Crystal structure of the asn-bound guinea pig l-asparaginase 1 catalytic domain active site mutant t116a (see paper)
34% identity, 98% coverage: 6:326/327 of query aligns to 2:352/357 of 5dndD
5ot0A The thermostable l-asparaginase from thermococcus kodakarensis (see paper)
32% identity, 98% coverage: 7:326/327 of query aligns to 2:326/328 of 5ot0A
Q8TZE8 L-asparaginase; EC 3.5.1.1 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see 2 papers)
29% identity, 95% coverage: 17:327/327 of query aligns to 6:326/326 of Q8TZE8
4q0mA Crystal structure of pyrococcus furiosus l-asparaginase (see paper)
29% identity, 95% coverage: 17:327/327 of query aligns to 7:327/327 of 4q0mA
1zq1A Structure of gatde tRNA-dependent amidotransferase from pyrococcus abyssi (see paper)
32% identity, 81% coverage: 61:326/327 of query aligns to 145:427/437 of 1zq1A
Sites not aligning to the query:
4njeA Crystal structure of pyrococcus furiosus l-asparaginase with ligand (see paper)
35% identity, 49% coverage: 17:175/327 of query aligns to 6:163/182 of 4njeA
5b5uA Crystal structure of truncated pyrococcus furiosus l-asparaginase with peptide (see paper)
35% identity, 49% coverage: 17:175/327 of query aligns to 6:163/175 of 5b5uA
Sites not aligning to the query:
5k45A Wolinella succinogenes l-asparaginase p121 + l-glutamic acid (see paper)
30% identity, 63% coverage: 61:267/327 of query aligns to 58:278/328 of 5k45A
Sites not aligning to the query:
5k3oA Wolinella succinogenes l-asparaginase p121 and l-aspartic acid (see paper)
30% identity, 63% coverage: 61:267/327 of query aligns to 58:278/328 of 5k3oA
Sites not aligning to the query:
2hlnA L-asparaginase from erwinia carotovora in complex with glutamic acid (see paper)
27% identity, 56% coverage: 7:190/327 of query aligns to 4:173/308 of 2hlnA
7c8qA Blasnase-t13a with d-asn (see paper)
24% identity, 96% coverage: 6:318/327 of query aligns to 2:320/321 of 7c8qA
8h4aB Blasnase-t13a/m57p
24% identity, 96% coverage: 6:318/327 of query aligns to 2:320/328 of 8h4aB
2gvnA L-asparaginase from erwinia carotovora in complex with aspartic acid (see paper)
29% identity, 56% coverage: 7:190/327 of query aligns to 4:190/325 of 2gvnA
6wyyA Crystal structure of pseudomonas 7a glutaminase-asparaginase in complex with l-glu at ph 6.5
26% identity, 80% coverage: 7:269/327 of query aligns to 4:267/315 of 6wyyA
Sites not aligning to the query:
7c8xA Blasnase-t13a with l-asn (see paper)
23% identity, 96% coverage: 6:318/327 of query aligns to 2:319/319 of 7c8xA
>GFF4005 FitnessBrowser__psRCH2:GFF4005
MNQPIERLLVLYTGGTIGMQQSAAGLMPASGFEARLRAQQALETGPLPSWTFRELQPLLD
SANMQPSHWLQMATAVREAVAQSDCDAVLLLHGTDTLAYSAAALSFLLLDLEIPVLLTGA
MLPAGSPGSDAWPNLFGAMRALQAGRVEGVRLFFNGVLLHGARVSKLRSDAFDAFAEAPR
KRSATVVGERPPMLLPQQPAQVVVLPLYPGVGAAQVQALVASGAQALLLECYGSGTGPAG
DAPFIEALRQAHRQGVVLAAISQCPGGHVDFGVYATGSGLRDAGLVSGGGMTREAALGKL
FALLTAGLNQAQVEHWFCRDLCGEMAN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory