SitesBLAST
Comparing GFF401 FitnessBrowser__Phaeo:GFF401 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2vu1A Biosynthetic thiolase from z. Ramigera. Complex of with o-pantheteine- 11-pivalate. (see paper)
43% identity, 98% coverage: 5:389/391 of query aligns to 5:389/391 of 2vu1A
1ou6A Biosynthetic thiolase from zoogloea ramigera in complex with acetyl-o- pantetheine-11-pivalate
43% identity, 98% coverage: 5:389/391 of query aligns to 6:390/392 of 1ou6A
- active site: C89 (= C90), H348 (= H347), C378 (= C377), G380 (= G379)
- binding pantothenyl-aminoethanol-acetate pivalic acid: L148 (≠ N139), H156 (vs. gap), M157 (= M146), F235 (≠ R234), A243 (= A242), S247 (= S246), A318 (= A317), F319 (= F318), H348 (= H347)
2vu2A Biosynthetic thiolase from z. Ramigera. Complex with s-pantetheine-11- pivalate. (see paper)
43% identity, 98% coverage: 5:389/391 of query aligns to 3:387/389 of 2vu2A
- active site: C86 (= C90), H345 (= H347), C375 (= C377), G377 (= G379)
- binding (3R)-3-hydroxy-2,2-dimethyl-4-oxo-4-({3-oxo-3-[(2-sulfanylethyl)amino]propyl}amino)butyl 2,2-dimethylpropanoate: H153 (vs. gap), M154 (= M146), F232 (≠ R234), S244 (= S246), G245 (≠ Q247), F316 (= F318), H345 (= H347)
1dm3A Acetylated biosynthetic thiolase from zoogloea ramigera in complex with acetyl-coa (see paper)
43% identity, 98% coverage: 5:389/391 of query aligns to 3:387/389 of 1dm3A
- active site: C86 (= C90), H345 (= H347), C375 (= C377), G377 (= G379)
- binding acetyl coenzyme *a: C86 (= C90), L145 (≠ N139), H153 (vs. gap), M154 (= M146), R217 (= R219), S224 (≠ G226), M225 (≠ L227), A240 (= A242), S244 (= S246), M285 (= M287), A315 (= A317), F316 (= F318), H345 (= H347), C375 (= C377)
1dlvA Biosynthetic thiolase from zoogloea ramigera in complex with coa (see paper)
43% identity, 98% coverage: 5:389/391 of query aligns to 3:387/389 of 1dlvA
- active site: C86 (= C90), H345 (= H347), C375 (= C377), G377 (= G379)
- binding coenzyme a: C86 (= C90), L145 (≠ N139), H153 (vs. gap), M154 (= M146), R217 (= R219), L228 (= L230), A240 (= A242), S244 (= S246), H345 (= H347)
P07097 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Shinella zoogloeoides (Crabtreella saccharophila) (see 2 papers)
42% identity, 99% coverage: 4:389/391 of query aligns to 5:390/392 of P07097
- Q64 (≠ H65) mutation to A: Slightly lower activity.
- C89 (= C90) mutation to A: Loss of activity.
- C378 (= C377) mutation to G: Loss of activity.
2wkuA Biosynthetic thiolase from z. Ramigera. The n316h mutant. (see paper)
43% identity, 98% coverage: 5:389/391 of query aligns to 3:387/389 of 2wkuA
- active site: C86 (= C90), H345 (= H347), C375 (= C377), G377 (= G379)
- binding D-mannose: S6 (= S8), A7 (= A9), R38 (= R41), K182 (= K174), D194 (= D186), V280 (≠ C282), D281 (≠ A283), T287 (≠ I289), P331 (≠ D333), S332 (≠ E334), V334 (≠ C336), V336 (= V338), F360 (≠ R362)
1m1oA Crystal structure of biosynthetic thiolase, c89a mutant, complexed with acetoacetyl-coa (see paper)
43% identity, 98% coverage: 5:389/391 of query aligns to 4:388/390 of 1m1oA
- active site: A87 (≠ C90), H346 (= H347), C376 (= C377), G378 (= G379)
- binding acetoacetyl-coenzyme a: L86 (≠ F89), A87 (≠ C90), L146 (≠ N139), H154 (vs. gap), M155 (= M146), R218 (= R219), S225 (≠ G226), M226 (≠ L227), A241 (= A242), G242 (= G243), S245 (= S246), A316 (= A317), F317 (= F318), H346 (= H347), I377 (= I378), G378 (= G379)
P09110 3-ketoacyl-CoA thiolase, peroxisomal; Acetyl-CoA C-myristoyltransferase; Acetyl-CoA acyltransferase; Beta-ketothiolase; Peroxisomal 3-oxoacyl-CoA thiolase; EC 2.3.1.16; EC 2.3.1.155; EC 2.3.1.9 from Homo sapiens (Human) (see 3 papers)
43% identity, 98% coverage: 5:389/391 of query aligns to 39:420/424 of P09110
- V387 (= V357) to A: in dbSNP:rs2229528
Sites not aligning to the query:
- 1:26 PTS2-type peroxisomal targeting signal
- 5 mutation Q->D,K,L: Does not affect localization to peroxisomes.
- 6 V→D: Abolished localization to peroxisomes.; V→K: Does not affect localization to peroxisomes.
- 7 mutation V->D,K: Abolished localization to peroxisomes.
- 8 mutation L->D,K: Does not affect localization to peroxisomes.
- 9 mutation G->D,R,L: Does not affect localization to peroxisomes.
- 10 H→E: In S3E mutant; Abolished localization to peroxisomes.
P14611 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
43% identity, 98% coverage: 1:385/391 of query aligns to 1:387/393 of P14611
- C88 (= C90) active site, Acyl-thioester intermediate; mutation to S: Almost complete loss of acetoacetyl-CoA thiolase activity.
- H156 (≠ A145) mutation to A: Almost complete loss of acetoacetyl-CoA thiolase activity.
- F219 (≠ C217) mutation to A: About 50% loss of acetoacetyl-CoA thiolase activity.; mutation to Y: 2-fold increase of acetoacetyl-CoA thiolase activity.
- R221 (= R219) mutation to A: Almost complete loss of acetoacetyl-CoA thiolase activity.
- S248 (= S246) mutation to A: About 40% loss of acetoacetyl-CoA thiolase activity.
- H349 (= H347) mutation to A: Almost complete loss of acetoacetyl-CoA thiolase activity.
- C379 (= C377) mutation to S: Almost complete loss of acetoacetyl-CoA thiolase activity.
5f38D X-ray crystal structure of a thiolase from escherichia coli at 1.8 a resolution (see paper)
40% identity, 99% coverage: 1:389/391 of query aligns to 3:393/394 of 5f38D
- active site: C90 (= C90), A348 (= A344), A378 (≠ V374), L380 (≠ M376)
- binding [(3~{S})-2,2-dimethyl-3-oxidanyl-4-oxidanylidene-4-[[3-oxidanylidene-3-(2-sulfanylethylamino)propyl]amino]butyl] phosphono hydrogen phosphate: C90 (= C90), L151 (vs. gap), A246 (= A242), S250 (= S246), I252 (≠ L248), A321 (= A317), F322 (= F318), H351 (= H347)
5f38B X-ray crystal structure of a thiolase from escherichia coli at 1.8 a resolution (see paper)
40% identity, 99% coverage: 1:389/391 of query aligns to 1:389/391 of 5f38B
- active site: C88 (= C90), H347 (= H347), C377 (= C377), G379 (= G379)
- binding coenzyme a: C88 (= C90), L149 (vs. gap), K219 (≠ R219), F234 (≠ R234), A242 (= A242), S246 (= S246), A317 (= A317), F318 (= F318), H347 (= H347)
4o9cC Crystal structure of beta-ketothiolase (phaa) from ralstonia eutropha h16 (see paper)
42% identity, 98% coverage: 1:385/391 of query aligns to 1:387/393 of 4o9cC
- active site: S88 (≠ C90), H349 (= H347), C379 (= C377), G381 (= G379)
- binding coenzyme a: S88 (≠ C90), L148 (≠ N139), R221 (= R219), F236 (≠ R234), A244 (= A242), S248 (= S246), L250 (= L248), A319 (= A317), F320 (= F318), H349 (= H347)
P45359 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; CaTHL; EC 2.3.1.9 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see paper)
39% identity, 99% coverage: 1:389/391 of query aligns to 1:390/392 of P45359
- V77 (≠ Q79) mutation to Q: 3-fold increase in thiolase activity, prevents disulfide bond formation under oxidized condition and results in the loss of regulatory mechanism based on redox-switch modulation; when associated with Y-153 and K-286.
- C88 (= C90) modified: Disulfide link with 378, In inhibited form
- S96 (≠ A98) binding
- N153 (≠ P140) mutation to Y: 3-fold increase in thiolase activity, prevents disulfide bond formation under oxidized condition and results in the loss of regulatory mechanism based on redox-switch modulation; when associated with Q-77 and K-286.
- GS 279:280 (≠ CV 278:279) binding
- A286 (≠ D285) mutation to K: 3-fold increase in thiolase activity, prevents disulfide bond formation under oxidized condition and results in the loss of regulatory mechanism based on redox-switch modulation; when associated with Q-77 and Y-153.
- C378 (= C377) modified: Disulfide link with 88, In inhibited form
- A386 (= A385) binding
2d3tC Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form v (see paper)
38% identity, 99% coverage: 2:389/391 of query aligns to 5:388/390 of 2d3tC
- active site: C94 (= C90), H346 (= H347), C376 (= C377), G378 (= G379)
- binding acetyl coenzyme *a: C94 (= C90), R214 (= R219), L222 (= L227), L225 (= L230), A238 (= A242), G239 (= G243), S242 (= S246), I244 (≠ L248), A313 (= A317), F314 (= F318), H346 (= H347), C376 (= C377)
4xl4A Crystal structure of thiolase from clostridium acetobutylicum in complex with coa (see paper)
38% identity, 99% coverage: 1:389/391 of query aligns to 1:390/392 of 4xl4A
- active site: C88 (= C90), H348 (= H347), S378 (≠ C377), G380 (= G379)
- binding coenzyme a: L148 (= L135), H156 (≠ Y143), R220 (= R219), L231 (= L230), A243 (= A242), S247 (= S246), F319 (= F318), H348 (= H347)
P42765 3-ketoacyl-CoA thiolase, mitochondrial; Acetyl-CoA acetyltransferase; Acetyl-CoA acyltransferase; Acyl-CoA hydrolase, mitochondrial; Beta-ketothiolase; Mitochondrial 3-oxoacyl-CoA thiolase; T1; EC 2.3.1.16; EC 2.3.1.9; EC 3.1.2.-; EC 3.1.2.1; EC 3.1.2.2 from Homo sapiens (Human) (see paper)
35% identity, 99% coverage: 1:389/391 of query aligns to 4:394/397 of P42765
- C92 (= C90) mutation to A: Decreased acyl-CoA hydrolase activity.; mutation to S: Decreased acyl-CoA hydrolase activity; when associated with A-382.
- R224 (= R219) binding
- T227 (= T222) binding
- S251 (= S246) binding
- C382 (= C377) mutation to S: Decreased acyl-CoA hydrolase activity; when associated with S-92.
4c2jD Crystal structure of human mitochondrial 3-ketoacyl-coa thiolase in complex with coa (see paper)
35% identity, 99% coverage: 1:389/391 of query aligns to 7:393/395 of 4c2jD
8opxC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with trehalose (fragment-b-tre)
39% identity, 99% coverage: 2:389/391 of query aligns to 2:396/398 of 8opxC
8oqmD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-10
39% identity, 99% coverage: 2:389/391 of query aligns to 3:397/399 of 8oqmD
Sites not aligning to the query:
Query Sequence
>GFF401 FitnessBrowser__Phaeo:GFF401
MKQAVIVSAARTGLAKSFRGSFNQTHGATLGGHAVAAAVERASLEGGVIEDCIIGCGFPE
GATGHNIGRQIALRAGLPQTAAGMTVNRFCASGLQTIALAAQQITAEGAGPMVAGGVESI
SMVQPNVTQVQDPWLQEHNPDVYMAMIDTADVVAERYGISREAQDAYGLRSQQKIAAAQD
AGIFDDEIVPMQTVMAVKDRDTGEISHREVTVNRDECNRPQTTLDGLAGLEPVRGAGKFI
TAGNASQLSDGAAAVVMMEADEASRRGLDPMGAFRGFCVAGCAPDEMGIGPVHAVPRLLE
RHGVTVADIDLWELNEAFASQALFCRDNLGIPDEICNVNGGSIAIGHPFGMTGARMVGHL
LREGHRRGAKLGVVTMCIGGGMGAAGLFEIY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory