Comparing GFF4018 FitnessBrowser__psRCH2:GFF4018 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6rl5G The first crystal structure of the daba aminotransferase ectb in the ectoine biosynthesis pathway of the model organism chromohalobacter salexigens dsm 3034 (see paper)
57% identity, 98% coverage: 2:418/425 of query aligns to 3:421/422 of 6rl5G
O66442 Acetylornithine aminotransferase; ACOAT; EC 2.6.1.11 from Aquifex aeolicus (strain VF5)
34% identity, 94% coverage: 11:408/425 of query aligns to 5:372/376 of O66442
2eh6A Crystal structure of acetylornithine aminotransferase from aquifex aeolicus vf5
34% identity, 93% coverage: 13:408/425 of query aligns to 6:371/375 of 2eh6A
1sffA Structure of gamma-aminobutyrate aminotransferase complex with aminooxyacetate (see paper)
32% identity, 93% coverage: 19:412/425 of query aligns to 23:420/425 of 1sffA
Sites not aligning to the query:
1sf2A Structure of e. Coli gamma-aminobutyrate aminotransferase (see paper)
32% identity, 93% coverage: 19:412/425 of query aligns to 23:420/425 of 1sf2A
Sites not aligning to the query:
P22256 4-aminobutyrate aminotransferase GabT; 5-aminovalerate transaminase; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; L-AIBAT; EC 2.6.1.19; EC 2.6.1.48 from Escherichia coli (strain K12) (see 2 papers)
32% identity, 93% coverage: 19:412/425 of query aligns to 24:421/426 of P22256
1szkA The structure of gamma-aminobutyrate aminotransferase mutant: e211s (see paper)
32% identity, 93% coverage: 19:412/425 of query aligns to 23:420/425 of 1szkA
Sites not aligning to the query:
4ppmA Crystal structure of pige: a transaminase involved in the biosynthesis of 2-methyl-3-n-amyl-pyrrole (map) from serratia sp. Fs14 (see paper)
32% identity, 94% coverage: 21:418/425 of query aligns to 47:456/464 of 4ppmA
Sites not aligning to the query:
P50457 4-aminobutyrate aminotransferase PuuE; GABA aminotransferase; GABA-AT; Gamma-amino-N-butyrate transaminase; GABA transaminase; Glutamate:succinic semialdehyde transaminase; EC 2.6.1.19 from Escherichia coli (strain K12) (see paper)
32% identity, 97% coverage: 1:413/425 of query aligns to 1:420/421 of P50457
Q9M8M7 Acetylornithine aminotransferase, chloroplastic/mitochondrial; ACOAT; Acetylornithine transaminase; AOTA; Protein HOPW1-1-INTERACTING 1; EC 2.6.1.11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 95% coverage: 11:415/425 of query aligns to 70:456/457 of Q9M8M7
Sites not aligning to the query:
A0A0J9X1Q5 Aminotransferase PigE; EC 2.6.1.- from Serratia sp. (strain FS14) (see paper)
34% identity, 79% coverage: 21:356/425 of query aligns to 418:740/853 of A0A0J9X1Q5
O58478 Alanine/serine racemase; ASR; Ala/Ser racemase; EC 5.1.1.-; EC 5.1.1.1 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see paper)
29% identity, 98% coverage: 8:424/425 of query aligns to 39:470/474 of O58478
8ht4B Crystal structure of acetylornithine aminotransferase complex with plp from corynebacterium glutamicum
30% identity, 93% coverage: 19:413/425 of query aligns to 18:390/390 of 8ht4B
1wkhA Acetylornithine aminotransferase from thermus thermophilus hb8
29% identity, 93% coverage: 20:413/425 of query aligns to 21:387/387 of 1wkhA
Sites not aligning to the query:
1wkgA Acetylornithine aminotransferase from thermus thermophilus hb8
29% identity, 93% coverage: 20:413/425 of query aligns to 21:387/387 of 1wkgA
Sites not aligning to the query:
1vefA Acetylornithine aminotransferase from thermus thermophilus hb8
29% identity, 93% coverage: 20:413/425 of query aligns to 21:387/387 of 1vefA
Sites not aligning to the query:
4uoxC Crystal structure of ygjg in complex with pyridoxal-5'-phosphate and putrescine (see paper)
29% identity, 91% coverage: 30:415/425 of query aligns to 74:450/456 of 4uoxC
Sites not aligning to the query:
4uoxA Crystal structure of ygjg in complex with pyridoxal-5'-phosphate and putrescine (see paper)
29% identity, 91% coverage: 30:415/425 of query aligns to 70:446/453 of 4uoxA
Sites not aligning to the query:
P42588 Putrescine aminotransferase; PAT; PATase; Cadaverine transaminase; Diamine transaminase; Putrescine transaminase; Putrescine--2-oxoglutaric acid transaminase; Putrescine:2-OG aminotransferase; EC 2.6.1.82; EC 2.6.1.29 from Escherichia coli (strain K12) (see paper)
29% identity, 91% coverage: 30:415/425 of query aligns to 76:452/459 of P42588
Q5SHH5 [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.118 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
29% identity, 93% coverage: 20:413/425 of query aligns to 29:395/395 of Q5SHH5
>GFF4018 FitnessBrowser__psRCH2:GFF4018
MKTFELNESKVRSYCRSFPVVFNQAQGAELVTQDGKRYIDFLAGAGTLNYGHNHPVLKQA
LLEYIENDGITHGLDMYTAAKERFLETFNRLILEPRGMGDYRMQFTGPTGTNAVEAAMKL
ARKVTGRNNIISFTNGFHGCSIGALAATGNQHHRGGSGISLTDVSRMPYANYFGDKTNTI
GMMDKLLSDPSSGIDKPAAVIVEVVQGEGGLNTASTEWMRKLEKLCRKHEMLLIVDDIQA
GCGRTGTFFSFEEMGIQPDIVTLSKSLSGYGLPFAMVLLRQELDQWKPGEHNGTFRGNNH
AFVTAAAAVEHFWQNDAFANSVKAKGKRIADGMQRIIRRHGPDSLYLKGRGMMIGISCPD
GEIAAAVCRHAFENGLVIETSGAHSEVVKCLCPLIISEEQIDKALAILDKAFAAVMSEQT
ENQAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory