SitesBLAST
Comparing GFF403 FitnessBrowser__Phaeo:GFF403 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6fahD Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
26% identity, 91% coverage: 5:351/381 of query aligns to 3:348/379 of 6fahD
- active site: L124 (≠ H128), T125 (≠ G129), G241 (≠ A243)
- binding flavin-adenine dinucleotide: F122 (= F126), L124 (≠ H128), T125 (≠ G129), R152 (= R156), F155 (≠ V159), T157 (≠ V161), E198 (≠ Q200), R267 (= R269), Q269 (= Q271), F270 (= F272), I274 (= I276), F277 (= F279), Q335 (= Q338), I336 (≠ L339), G339 (= G342)
Sites not aligning to the query:
3mpiC Structure of the glutaryl-coenzyme a dehydrogenase glutaryl-coa complex (see paper)
28% identity, 93% coverage: 1:356/381 of query aligns to 1:358/395 of 3mpiC
- active site: I128 (≠ H128), T129 (≠ G129), T245 (≠ A243)
- binding flavin-adenine dinucleotide: I128 (≠ H128), T129 (≠ G129), G134 (≠ R134), S135 (≠ Y135), W159 (≠ V159), I160 (≠ V160), S161 (≠ V161)
- binding glutaryl-coenzyme A: R87 (≠ E85), F126 (= F126), S135 (≠ Y135), V137 (≠ R137), S181 (≠ D181), F239 (≠ E237), R246 (≠ E244), N315 (≠ V313)
Sites not aligning to the query:
- active site: 367, 379
- binding flavin-adenine dinucleotide: 365, 366, 369, 371, 375
- binding glutaryl-coenzyme A: 366, 367, 368, 376, 385, 389
3mpjB Structure of the glutaryl-coenzyme a dehydrogenase (see paper)
28% identity, 93% coverage: 1:356/381 of query aligns to 1:358/393 of 3mpjB
- active site: I128 (≠ H128), T129 (≠ G129), T245 (≠ A243)
- binding flavin-adenine dinucleotide: F126 (= F126), I128 (≠ H128), T129 (≠ G129), G134 (≠ R134), S135 (≠ Y135), W159 (≠ V159), I160 (≠ V160), S161 (≠ V161)
- binding : H36 (≠ P36), F37 (≠ S37), Y39 (= Y39), A164 (≠ E164), Q165 (≠ A165), D167 (≠ E167), N193 (vs. gap)
Sites not aligning to the query:
C3UVB0 Glutaryl-CoA dehydrogenase; GDH(Des); EC 1.3.99.32 from Desulfococcus multivorans (see paper)
28% identity, 93% coverage: 1:356/381 of query aligns to 1:358/389 of C3UVB0
- A80 (≠ G79) mutation to E: Loses the FAD cofactor and dehydrogenase activity.
- R87 (≠ E85) binding
- V88 (≠ P86) mutation to S: A residual dehydrogenase activity is observed.
- N91 (≠ D89) binding
- FGIT 126:129 (≠ FAHG 126:129) binding
- S135 (≠ Y135) binding ; binding
- WIS 159:161 (≠ VVV 159:161) binding
- S181 (≠ D181) binding
- R271 (= R269) binding
- FQMN 281:284 (≠ FQAL 279:282) binding
- R340 (≠ Q338) binding
- A344 (≠ G342) binding
Sites not aligning to the query:
- 366 V→Y: Loses the FAD cofactor but a residual dehydrogenase activity is observed.
- 367:371 binding
- 385 binding
5ol2F The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
27% identity, 86% coverage: 46:371/381 of query aligns to 43:368/378 of 5ol2F
- active site: L124 (≠ H128), T125 (≠ G129), G241 (≠ A243)
- binding coenzyme a persulfide: L238 (= L240), R242 (≠ E244), E362 (≠ F365), G363 (= G366)
- binding flavin-adenine dinucleotide: F122 (= F126), L124 (≠ H128), T125 (≠ G129), P127 (= P131), T131 (≠ Y135), F155 (≠ V159), I156 (≠ V160), T157 (≠ V161), E198 (≠ Q200), R267 (= R269), F270 (= F272), L274 (≠ I276), F277 (= F279), Q335 (= Q338), L336 (= L339), G338 (= G341), G339 (= G342), Y361 (≠ R364), T364 (≠ D367), E366 (≠ D369)
Sites not aligning to the query:
6wy8C Tcur3481-tcur3483 steroid acad (see paper)
31% identity, 100% coverage: 1:380/381 of query aligns to 1:359/364 of 6wy8C
6es9A Methylsuccinyl-coa dehydrogenase of paracoccus denitrificans with bound flavin adenine dinucleotide (see paper)
27% identity, 92% coverage: 5:354/381 of query aligns to 161:518/545 of 6es9A
- active site: F281 (≠ H128), T282 (≠ G129), A408 (= A243)
- binding coenzyme a: F467 (≠ N302), W470 (≠ G305)
- binding flavin-adenine dinucleotide: A279 (≠ F126), F281 (≠ H128), T282 (≠ G129), G287 (≠ R134), S288 (≠ Y135), W312 (≠ V159), I313 (≠ V160), T314 (≠ V161), E374 (vs. gap), R434 (= R269), Q436 (= Q271), F437 (= F272), L441 (≠ I276), F444 (= F279), Q502 (= Q338), I503 (≠ L339), G505 (= G341), G506 (= G342)
Sites not aligning to the query:
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
28% identity, 92% coverage: 1:349/381 of query aligns to 1:347/380 of 4l1fA
- active site: L125 (≠ H128), T126 (≠ G129), G242 (≠ A243)
- binding coenzyme a persulfide: T132 (≠ Y135), H179 (≠ R182), F232 (≠ A232), M236 (≠ V236), E237 (= E237), L239 (= L240), D240 (≠ A241), R243 (≠ E244)
- binding flavin-adenine dinucleotide: F123 (= F126), L125 (≠ H128), T126 (≠ G129), G131 (≠ R134), T132 (≠ Y135), F156 (≠ V159), I157 (≠ V160), T158 (≠ V161), R268 (= R269), Q270 (= Q271), F271 (= F272), I275 (= I276), F278 (= F279), L281 (= L282), Q336 (= Q338), I337 (≠ L339), G340 (= G342)
- binding 1,3-propandiol: L5 (= L5), Q10 (= Q10)
Sites not aligning to the query:
6wy9B Tcur3481-tcur3483 steroid acad g363a variant (see paper)
30% identity, 99% coverage: 5:380/381 of query aligns to 2:356/361 of 6wy9B
6af6A Piga with fad and proline (see paper)
26% identity, 98% coverage: 1:373/381 of query aligns to 1:373/383 of 6af6A
- active site: A127 (≠ H128), T128 (≠ G129), A244 (= A243)
- binding flavin-adenine dinucleotide: N125 (≠ F126), A127 (≠ H128), T128 (≠ G129), G133 (≠ R134), S134 (≠ Y135), F158 (≠ V159), I159 (≠ V160), T160 (≠ V161), W211 (≠ A210), I363 (≠ H363), F364 (≠ R364), T367 (≠ D367), D369 (= D369), I370 (≠ T370)
- binding 1,4,7,10,13,16-hexaoxacyclooctadecane: L41 (≠ I43), K44 (≠ Q46), K275 (≠ R274), F280 (= F279)
- binding proline: G133 (≠ R134), I136 (≠ R137), F237 (≠ V236), M241 (≠ L240), S365 (≠ F365)
Sites not aligning to the query:
4n5fA Crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315
30% identity, 92% coverage: 1:351/381 of query aligns to 2:350/378 of 4n5fA
Sites not aligning to the query:
P28330 Long-chain specific acyl-CoA dehydrogenase, mitochondrial; LCAD; EC 1.3.8.8 from Homo sapiens (Human) (see 2 papers)
24% identity, 91% coverage: 5:352/381 of query aligns to 53:399/430 of P28330
- E291 (≠ A243) active site, Proton acceptor; mutation to Q: Loss of long-chain-acyl-CoA dehydrogenase activity. No effect on protein abundance. No effect on solubility. No effect on substrate binding.
- S303 (≠ M255) to T: in dbSNP:rs1801204
- K333 (≠ R285) to Q: in dbSNP:rs2286963
2pg0A Crystal structure of acyl-coa dehydrogenase from geobacillus kaustophilus
27% identity, 94% coverage: 5:361/381 of query aligns to 5:360/380 of 2pg0A
- active site: M124 (≠ H128), T125 (≠ G129), E243 (≠ A243)
- binding flavin-adenine dinucleotide: I122 (≠ F126), M124 (≠ H128), T125 (≠ G129), G130 (≠ R134), S131 (≠ Y135), F155 (≠ V159), I156 (≠ V160), T157 (≠ V161), R269 (= R269), F272 (= F272), F279 (= F279), Q337 (= Q338), L338 (= L339), G340 (= G341), G341 (= G342), V359 (≠ M360)
Sites not aligning to the query:
7p9xA Structure of cyclohex-1-ene-1-carboxyl-coa dehydrogenase complexed with cyclohex-1-ene-1-carboxyl-coa (see paper)
28% identity, 89% coverage: 4:342/381 of query aligns to 1:338/378 of 7p9xA
- binding 1-monoenoyl-CoA: L82 (≠ V87), D89 (≠ C94), S129 (≠ Y135), L131 (≠ R137), K176 (≠ R182), F229 (≠ A233), M233 (≠ E237), L236 (= L240), R240 (≠ E244)
- binding flavin-adenine dinucleotide: A122 (≠ H128), T123 (≠ G129), G128 (≠ R134), S129 (≠ Y135), F153 (≠ V159), I154 (≠ V160), T155 (≠ V161), N206 (≠ A210)
Sites not aligning to the query:
7p9aA Structure of cyclohex-1-ene-1-carboxyl-coa dehydrogenase complexed with cyclohex-1,5-diene-1-carboxyl-coa (see paper)
28% identity, 89% coverage: 4:342/381 of query aligns to 3:340/380 of 7p9aA
- binding 1,5 Dienoyl-CoA: S131 (≠ Y135), L133 (≠ R137), K178 (≠ R182), F231 (≠ A233), M235 (≠ E237), L238 (= L240), N241 (≠ A243), R242 (≠ E244)
- binding flavin-adenine dinucleotide: L122 (≠ F126), A124 (≠ H128), T125 (≠ G129), G130 (≠ R134), S131 (≠ Y135), F155 (≠ V159), I156 (≠ V160), T157 (≠ V161), K200 (≠ S202), N208 (≠ A210)
Sites not aligning to the query:
P26440 Isovaleryl-CoA dehydrogenase, mitochondrial; IVD; Butyryl-CoA dehydrogenase; EC 1.3.8.4; EC 1.3.8.1 from Homo sapiens (Human) (see 5 papers)
25% identity, 98% coverage: 5:376/381 of query aligns to 45:416/426 of P26440
- 165:174 (vs. 126:135, 30% identical) binding
- S174 (≠ Y135) binding
- WIT 198:200 (≠ VVV 159:161) binding
- SR 222:223 (≠ RD 182:183) binding
- G250 (= G207) to A: in IVA; uncertain significance
- Y277 (≠ V234) binding
- DLER 284:287 (≠ AAAE 241:244) binding
- E286 (≠ A243) active site, Proton acceptor; mutation to D: Residual isovaleryl-CoA dehydrogenase activity.; mutation to G: Loss of isovaleryl-CoA dehydrogenase activity. Does not affect isovaleryl-CoA dehydrogenase activity; when associated with 407-E.; mutation to Q: Loss of isovaleryl-CoA dehydrogenase activity.
- A291 (= A248) to V: in IVA; uncertain significance; dbSNP:rs886042098
- R312 (= R269) binding
- Q323 (= Q280) binding
- I379 (= I337) to T: in IVA; uncertain significance
- QCFGG 380:384 (≠ QLHGG 338:342) binding
- R398 (≠ K356) to Q: in IVA; uncertain significance; dbSNP:rs1477527791
- Y403 (≠ S361) to N: in IVA; uncertain significance
- A407 (≠ D367) mutation to E: Does not affect isovaleryl-CoA dehydrogenase activity; when associated with 286-D.
- AG 407:408 (≠ DA 367:368) binding
- TSE 409:411 (≠ DTQ 369:371) binding
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
8sgrA Isovaleryl-CoA dehydrogenase, mitochondrial (see paper)
25% identity, 98% coverage: 5:376/381 of query aligns to 12:383/393 of 8sgrA
- binding flavin-adenine dinucleotide: S135 (≠ G129), G140 (≠ R134), S141 (≠ Y135), W165 (≠ V159), T167 (≠ V161), R279 (= R269), F282 (= F272), I286 (= I276), F289 (= F279), Q347 (= Q338), C348 (≠ L339), G351 (= G342), L369 (≠ M360), G375 (≠ A368), T376 (≠ D369), L382 (≠ F375)
1ivhA Structure of human isovaleryl-coa dehydrogenase at 2.6 angstroms resolution: structural basis for substrate specificity (see paper)
25% identity, 98% coverage: 5:376/381 of query aligns to 8:379/387 of 1ivhA
- active site: M130 (≠ H128), S131 (≠ G129), E249 (≠ A243), A370 (≠ D367)
- binding coenzyme a persulfide: S137 (≠ Y135), S185 (≠ R182), R186 (≠ D183), V239 (≠ A233), Y240 (≠ V234), M243 (≠ E237), E249 (≠ A243), R250 (≠ E244), G369 (= G366), A370 (≠ D367), G371 (≠ A368), V375 (≠ L372)
- binding flavin-adenine dinucleotide: L128 (≠ F126), M130 (≠ H128), S131 (≠ G129), G136 (≠ R134), S137 (≠ Y135), W161 (≠ V159), T163 (≠ V161), R275 (= R269), F278 (= F272), F285 (= F279), M288 (≠ L282), Q343 (= Q338), C344 (≠ L339), G347 (= G342), T372 (≠ D369), E374 (≠ Q371)
Sites not aligning to the query:
4ktoA Crystal structure of a putative isovaleryl-coa dehydrogenase (psi- nysgrc-012251) from sinorhizobium meliloti 1021
29% identity, 92% coverage: 1:349/381 of query aligns to 6:344/377 of 4ktoA
- active site: M130 (≠ H128), S131 (≠ G129), E239 (≠ A243)
- binding flavin-adenine dinucleotide: L128 (≠ F126), M130 (≠ H128), S131 (≠ G129), M155 (≠ S158), W156 (≠ V159), T158 (≠ V161), R265 (= R269), F268 (= F272), I272 (= I276), F275 (= F279), M278 (≠ L282), Q333 (= Q338), A334 (≠ L339), G337 (= G342)
Sites not aligning to the query:
7szvA Crystal structure of acyl-coa dehydrogenase from mycobacterium marinum in complex with fda
27% identity, 91% coverage: 5:352/381 of query aligns to 2:343/372 of 7szvA
- binding dihydroflavine-adenine dinucleotide: L122 (≠ H128), T123 (≠ G129), F153 (≠ V159), I154 (≠ V160), T155 (≠ V161), K194 (≠ G196), R261 (= R269), S263 (≠ Q271), Y271 (≠ F279), I274 (≠ L282), Q329 (= Q338), V330 (≠ L339), G332 (= G341), G333 (= G342)
Sites not aligning to the query:
Query Sequence
>GFF403 FitnessBrowser__Phaeo:GFF403
MNFQLTEERQMLQDSLRRFLADRYTVTARNKAIADPSGYSSAIWTQLADLGVLGALLPEA
VGGYGGAGFDIATIFEELGRAGVVEPVLDTAVLCGSLLCGPHDAQPLPRDRQYLERLIAG
DLQLAFAHGEPASRYERTWVETTATVGGQDIVLTGRKSVVVNAEAAELLIVSAREGGASG
DRDGLSLFLVDPKTAGVRMQGSALLAGGRAGEIELDGVRLSPSARLGAAGGAAVRVESAL
AAAEVALAAEALGAMETATRLTMDYLTTRQQFGRPIGTFQALQHRVAEMLIEVEQARSAV
INAAGHLEGAPQVRDRHIAAARNLIGRTGRHIAEEAIQLHGGIAMTAEYELAHIAKRIVM
SEHRFGDADTQLERFIDLSAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory