SitesBLAST
Comparing GFF4089 FitnessBrowser__Marino:GFF4089 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
35% identity, 95% coverage: 4:338/353 of query aligns to 2:334/334 of P0DPQ8
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
35% identity, 95% coverage: 4:338/353 of query aligns to 1:333/333 of 5ogxA
- binding flavin-adenine dinucleotide: Y132 (= Y137), R144 (= R149), Q145 (≠ A150), Y146 (≠ F151), S147 (= S152), H161 (= H166), V162 (= V167), V165 (= V170), G168 (= G173), V169 (≠ A174), A170 (= A175), T171 (= T176), T214 (≠ S215), F329 (= F334), P331 (≠ T336), S333 (≠ A338)
- binding fe2/s2 (inorganic) cluster: C34 (= C37), N35 (≠ G38), G37 (= G40), C39 (= C42), G40 (≠ A43), C42 (= C45), C74 (= C77)
Q03304 Toluene-4-monooxygenase system, ferredoxin--NAD(+) reductase component; T4MO; Ferredoxin--NAD(+) reductase; Toluene-4-monooxygenase systme, electron transfer component; EC 1.18.1.3 from Pseudomonas mendocina (see paper)
31% identity, 87% coverage: 13:320/353 of query aligns to 12:310/326 of Q03304
4wqmA Structure of the toluene 4-monooxygenase nadh oxidoreductase t4mof, k270s k271s variant (see paper)
31% identity, 87% coverage: 13:320/353 of query aligns to 12:310/326 of 4wqmA
- binding flavin-adenine dinucleotide: C36 (= C37), S38 (≠ H39), W57 (≠ I56), Y135 (= Y137), R146 (= R149), A147 (= A150), Y148 (≠ F151), S149 (= S152), I162 (≠ H166), V163 (= V167), G169 (= G173), K170 (≠ A174), V171 (≠ A175), S172 (≠ T176), S209 (= S215)
- binding fe2/s2 (inorganic) cluster: Y34 (≠ F35), C36 (= C37), N37 (≠ G38), G39 (= G40), C41 (= C42), G42 (≠ A43), C44 (= C45), C76 (= C77)
Sites not aligning to the query:
7c3bC Ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) (see paper)
31% identity, 88% coverage: 20:328/353 of query aligns to 23:326/334 of 7c3bC
1krhA X-ray structure of benzoate dioxygenase reductase (see paper)
29% identity, 91% coverage: 14:334/353 of query aligns to 17:334/337 of 1krhA
- active site: C306 (= C306)
- binding flavin-adenine dinucleotide: Y143 (= Y137), R155 (= R149), S156 (≠ A150), Y157 (≠ F151), S158 (= S152), V171 (≠ H166), V172 (= V167), G178 (= G173), K179 (≠ A174), M180 (≠ A175), S181 (≠ T176), T219 (≠ S215), E332 (= E332), F334 (= F334)
- binding fe2/s2 (inorganic) cluster: M38 (≠ F35), D39 (≠ A36), C40 (= C37), R41 (≠ G38), G43 (= G40), C45 (= C42), G46 (≠ A43), C48 (= C45), C82 (= C77)
Sites not aligning to the query:
7c3aA Ferredoxin reductase in carbazole 1,9a-dioxygenase (see paper)
29% identity, 88% coverage: 20:328/353 of query aligns to 22:313/321 of 7c3aA
- binding flavin-adenine dinucleotide: C39 (= C37), S41 (≠ H39), W60 (≠ D58), R152 (= R149), A153 (= A150), Y154 (≠ F151), S155 (= S152), Y169 (≠ H166), I170 (≠ V167), G176 (= G173), R177 (≠ A174), F178 (≠ A175), S179 (≠ T176), A218 (≠ S215)
- binding fe2/s2 (inorganic) cluster: Y37 (≠ F35), C39 (= C37), A40 (≠ G38), G42 (= G40), C44 (= C42), G45 (≠ A43), C47 (= C45), C80 (= C77)
Sites not aligning to the query:
8a1uF Sodium pumping nadh-quinone oxidoreductase with substrates nadh and q2 (see paper)
29% identity, 79% coverage: 57:334/353 of query aligns to 87:405/405 of 8a1uF
- binding flavin-adenine dinucleotide: Y166 (= Y137), R209 (= R149), A210 (= A150), Y211 (≠ F151), S212 (= S152), A230 (≠ V170), P233 (vs. gap), V239 (vs. gap), P240 (≠ E171), G242 (= G173), Q243 (≠ A174), M244 (≠ A175), A282 (≠ S215), F405 (= F334)
- binding fe2/s2 (inorganic) cluster: C110 (= C77)
- binding 1,4-dihydronicotinamide adenine dinucleotide: S212 (= S152), R228 (= R168), G281 (= G214), A282 (≠ S215), G309 (= G241), R311 (= R243), S339 (= S271), F353 (≠ Y285), C377 (= C306), G378 (= G307), P379 (= P308), M381 (≠ P310), M382 (= M311), D403 (≠ E332)
Sites not aligning to the query:
8a1yF Sodium pumping nadh-quinone oxidoreductase with inhibitor hqno (see paper)
29% identity, 79% coverage: 57:334/353 of query aligns to 88:406/408 of 8a1yF
- binding flavin-adenine dinucleotide: R210 (= R149), A211 (= A150), Y212 (≠ F151), S213 (= S152), V228 (= V167), R229 (= R168), A231 (≠ V170), V240 (vs. gap), P241 (≠ E171), G243 (= G173), Q244 (≠ A174), M245 (≠ A175)
- binding fe2/s2 (inorganic) cluster: C111 (= C77)
Sites not aligning to the query:
A5F5Y4 Na(+)-translocating NADH-quinone reductase subunit F; Na(+)-NQR subunit F; Na(+)-translocating NQR subunit F; NQR complex subunit F; NQR-1 subunit F; EC 7.2.1.1 from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) (see paper)
29% identity, 79% coverage: 57:334/353 of query aligns to 88:406/408 of A5F5Y4
- C111 (= C77) binding ; mutation to A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
- R210 (= R149) mutation to L: Decreases flavin content, but does not affect the 2Fe-2S center. Exhibits very low NADH:quinone oxidoreductase activity.
- Y212 (≠ F151) mutation to L: Decreases flavin content, but does not affect the 2Fe-2S center. Exhibits very low NADH:quinone oxidoreductase activity.
- S246 (≠ T176) mutation to A: Decreases flavin content, but does not affect the 2Fe-2S center. Exhibits very low NADH:quinone oxidoreductase activity.
Sites not aligning to the query:
- 70 binding ; C→A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
- 76 binding ; C→A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
- 79 binding ; C→A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
7qu0A X-ray structure of fad domain of nqrf of klebsiella pneumoniae (see paper)
33% identity, 53% coverage: 149:334/353 of query aligns to 83:279/279 of 7qu0A
- binding ~{N}-[2,6-bis(fluoranyl)phenyl]ethanamide: S213 (= S271), F227 (≠ Y285), M256 (= M311)
- binding flavin-adenine dinucleotide: R83 (= R149), A84 (= A150), Y85 (≠ F151), S86 (= S152), A104 (≠ V170), T105 (vs. gap), P106 (vs. gap), P107 (vs. gap), A113 (vs. gap), P114 (≠ E171), P115 (≠ G172), G116 (= G173), I117 (≠ A174), M118 (≠ A175), S119 (≠ T176), F279 (= F334)
Sites not aligning to the query:
7qtyA X-ray structure of fad domain of nqrf of klebsiella pneumoniae (see paper)
33% identity, 53% coverage: 149:334/353 of query aligns to 83:279/279 of 7qtyA
- binding 1-(furan-2-ylmethyl)-3-(2-methylphenyl)thiourea: A184 (= A242), R185 (= R243), S213 (= S271), F227 (≠ Y285), H229 (= H287), V255 (≠ P310), M256 (= M311)
- binding flavin-adenine dinucleotide: R83 (= R149), A84 (= A150), Y85 (≠ F151), S86 (= S152), N100 (≠ H166), A104 (≠ V170), T105 (vs. gap), P107 (vs. gap), A113 (vs. gap), P114 (≠ E171), G116 (= G173), I117 (≠ A174), M118 (≠ A175), S119 (≠ T176), F279 (= F334)
Sites not aligning to the query:
1tvcA Fad and nadh binding domain of methane monooxygenase reductase from methylococcus capsulatus (bath) (see paper)
29% identity, 60% coverage: 127:338/353 of query aligns to 39:248/250 of 1tvcA
- active site: Y63 (≠ F151), S64 (= S152), L215 (= L305)
- binding dihydroflavine-adenine dinucleotide: F49 (≠ Y137), R61 (= R149), S62 (≠ A150), Y63 (≠ F151), S64 (= S152), L78 (≠ H166), I79 (≠ V167), R80 (= R168), L82 (≠ V170), F87 (≠ A175), G128 (= G216), N155 (≠ R243), E159 (= E247), S186 (≠ E274), G187 (≠ E275), E242 (= E332), F244 (= F334), L245 (= L335)
Sites not aligning to the query:
4u9uA Crystal structure of nqrf fad-binding domain from vibrio cholerae (see paper)
31% identity, 53% coverage: 149:334/353 of query aligns to 81:277/279 of 4u9uA
- binding flavin-adenine dinucleotide: R81 (= R149), A82 (= A150), Y83 (≠ F151), S84 (= S152), N98 (≠ H166), A102 (≠ V170), T103 (vs. gap), P104 (vs. gap), V111 (vs. gap), P112 (≠ E171), G114 (= G173), Q115 (≠ A174), M116 (≠ A175), S117 (≠ T176), F277 (= F334)
- binding magnesium ion: R186 (≠ A246), M188 (≠ L248)
- binding sodium ion: A198 (≠ D258), N201 (≠ H261), D202 (= D262), F204 (= F264)
Sites not aligning to the query:
7c3bB Ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) (see paper)
28% identity, 88% coverage: 20:328/353 of query aligns to 22:298/306 of 7c3bB
7qu3A X-ray structure of fad domain of nqrf of pseudomonas aeruginosa (see paper)
27% identity, 66% coverage: 101:334/353 of query aligns to 2:278/279 of 7qu3A
- binding flavin-adenine dinucleotide: Y40 (= Y137), R83 (= R149), A84 (= A150), Y85 (≠ F151), S86 (= S152), N100 (≠ H166), A104 (vs. gap), S105 (vs. gap), L112 (≠ V170), P113 (≠ E171), G115 (= G173), Q116 (≠ A174), M117 (≠ A175), S118 (≠ T176), A155 (≠ S215), F278 (= F334)
- binding 4-(benzimidazol-1-ylmethyl)benzenecarbonitrile: R102 (= R168), G154 (= G214), G182 (= G241), F226 (≠ Y285), I227 (≠ V286), P252 (= P309), M255 (≠ I312)
7qu5A X-ray structure of fad domain of nqrf of pseudomonas aeruginosa (see paper)
27% identity, 66% coverage: 101:334/353 of query aligns to 2:278/280 of 7qu5A
- binding flavin-adenine dinucleotide: Y40 (= Y137), R83 (= R149), A84 (= A150), Y85 (≠ F151), S86 (= S152), N100 (≠ H166), A104 (vs. gap), L112 (≠ V170), P113 (≠ E171), G115 (= G173), Q116 (≠ A174), M117 (≠ A175), S118 (≠ T176), A155 (≠ S215), F278 (= F334)
- binding gamma-Valerolactone: F19 (≠ T118), F68 (vs. gap), M70 (vs. gap), S105 (vs. gap), P108 (vs. gap), D196 (≠ E255), W207 (≠ Y266), H208 (≠ V267), L209 (≠ P268)
2r6hC Crystal structure of the domain comprising the NAD binding and the fad binding regions of the nadh:ubiquinone oxidoreductase, na translocating, f subunit from porphyromonas gingivalis
30% identity, 47% coverage: 149:314/353 of query aligns to 86:268/289 of 2r6hC
- active site: C260 (= C306)
- binding flavin-adenine dinucleotide: R86 (= R149), A87 (= A150), Y88 (≠ F151), S89 (= S152), N103 (≠ H166), A107 (vs. gap), T108 (vs. gap), I122 (≠ V170), K123 (≠ E171), P124 (≠ G172), G125 (= G173), I126 (≠ A174), S127 (≠ A175), S128 (≠ T176)
Sites not aligning to the query:
2eixA The structure of physarum polycephalum cytochrome b5 reductase (see paper)
28% identity, 54% coverage: 135:324/353 of query aligns to 45:230/243 of 2eixA
- active site: H47 (≠ Y137), Y63 (≠ A154), T64 (≠ N155), C217 (= C306)
- binding flavin-adenine dinucleotide: R61 (≠ S152), P62 (≠ L153), Y63 (≠ A154), T64 (≠ N155), I78 (≠ H166), Y82 (≠ V170), K84 (≠ G172), G85 (= G173), M87 (≠ A175), S88 (≠ T176), T126 (≠ S215), T129 (≠ S218), F195 (≠ Y285), M221 (≠ P310), A225 (= A314)
3ozwA The crystal structure of flavohemoglobin from r. Eutrophus in complex with ketoconazole (see paper)
26% identity, 58% coverage: 130:334/353 of query aligns to 183:396/403 of 3ozwA
- binding flavin-adenine dinucleotide: R206 (= R149), Q207 (≠ A150), Y208 (≠ F151), S209 (= S152), S222 (≠ E164), V223 (≠ L165), K224 (≠ H166), E226 (= E171), P232 (vs. gap), G234 (vs. gap), Y235 (vs. gap), V236 (≠ A175), S237 (≠ T176), V276 (≠ S215), T279 (≠ S219), V395 (≠ K333), F396 (= F334)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 50
- binding protoporphyrin ix containing fe: 42, 43, 81, 85, 88, 90, 94, 95, 98, 126, 130, 133
- binding 1-acetyl-4-(4-{[(2R,4S)-2-(2,4-dichlorophenyl)-2-(1H-imidazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy}phenyl)piperazine: 53, 56, 102, 398
Query Sequence
>GFF4089 FitnessBrowser__Marino:GFF4089
MSHTVTIEPIGEQIEVEDGQTILQAALRQGVWLPFACGHGTCATCKVQVLEGDVEIGDAS
PFALMDIERDEGKVLACCATVESDVTIEADIDVDPDFEGYPVEDYTATVTGIVELSPTIR
GVHLKLDRPMTFQAGQYINIELPGVDGARAFSLANPPGKADEVELHVRLVEGGAATTYIH
EQLKTGDALNLSGPYGQFFVRSSQPGDLIFIAGGSGLSSPQSMILDLLEQNDERKIVLFQ
GARNLAELYNRELFEALDRDHDNFTYVPALSQAEEDAEWQGFRGYVHDAAKAHFDGRFAG
NKAYLCGPPPMIDAAITALMQGRLFERDIFMEKFLTAADGAEDTQRSALFKKI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory