Comparing GFF4093 FitnessBrowser__Marino:GFF4093 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2d0dA Crystal structure of a meta-cleavage product hydrolase (cumd) a129v mutant (see paper)
63% identity, 94% coverage: 9:277/285 of query aligns to 3:271/271 of 2d0dA
1iunB Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant hexagonal (see paper)
62% identity, 95% coverage: 9:278/285 of query aligns to 4:273/276 of 1iunB
1ukaA Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with (s)-2-methylbutyrate (see paper)
62% identity, 94% coverage: 9:277/285 of query aligns to 3:271/271 of 1ukaA
1uk9A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with isovalerate (see paper)
62% identity, 94% coverage: 9:277/285 of query aligns to 3:271/271 of 1uk9A
1uk8A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with n-valerate (see paper)
62% identity, 94% coverage: 9:277/285 of query aligns to 3:271/271 of 1uk8A
1uk7A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with n-butyrate (see paper)
62% identity, 94% coverage: 9:277/285 of query aligns to 3:271/271 of 1uk7A
1iupA Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant complexed with isobutyrates (see paper)
62% identity, 94% coverage: 9:277/285 of query aligns to 3:271/271 of 1iupA
Q9AQM4 2-hydroxy-6-oxo-6-(2'-aminophenyl)hexa-2,4-dienoic acid hydrolase; HOPDA; EC 3.7.1.13 from Pseudomonas resinovorans (see paper)
35% identity, 95% coverage: 6:275/285 of query aligns to 13:280/290 of Q9AQM4
2og1A Crystal structure of bphd, a c-c hydrolase from burkholderia xenovorans lb400 (see paper)
37% identity, 93% coverage: 13:277/285 of query aligns to 13:285/285 of 2og1A
P47229 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase; HOPDA hydrolase; 2,6-dioxo-6-phenylhexa-3-enoate hydrolase; EC 3.7.1.8 from Paraburkholderia xenovorans (strain LB400) (see paper)
37% identity, 93% coverage: 13:277/285 of query aligns to 14:286/286 of P47229
P9WNH5 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase; 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase; HOPDA hydrolase; Meta-cleavage product hydrolase; MCP hydrolase; EC 3.7.1.17; EC 3.7.1.8 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 85% coverage: 32:274/285 of query aligns to 39:287/291 of P9WNH5
2rhwA Crystal structure of the s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with 3,10-di-fluoro hopda (see paper)
37% identity, 93% coverage: 13:277/285 of query aligns to 11:283/283 of 2rhwA
2rhtA Crystal structure of the s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with 3-cl hopda (see paper)
37% identity, 93% coverage: 13:277/285 of query aligns to 11:283/283 of 2rhtA
2puhA Crystal structure of the s112a mutant of a c-c hydrolase, bphd from burkholderia xenovorans lb400, in complex with its substrate hopda (see paper)
37% identity, 93% coverage: 13:277/285 of query aligns to 11:283/283 of 2puhA
7zm4A Crystal structure of hsad from mycobacterium tuberculosis in complex with cyclipostin-like inhibitor cyc31 (see paper)
36% identity, 85% coverage: 32:274/285 of query aligns to 33:281/284 of 7zm4A
7zm3A Crystal structure of hsad from mycobacterium tuberculosis in complex with cyclipostin-like inhibitor cyc17 (see paper)
36% identity, 85% coverage: 32:274/285 of query aligns to 33:281/284 of 7zm3A
7zm2A Crystal structure of hsad from mycobacterium tuberculosis in complex with cyclophostin-like inhibitor cyc8b (see paper)
36% identity, 85% coverage: 32:274/285 of query aligns to 33:281/284 of 7zm2A
7zm1A Crystal structure of hsad from mycobacterium tuberculosis in complex with cyclophostin-like inhibitor cyc7b (see paper)
36% identity, 85% coverage: 32:274/285 of query aligns to 33:281/284 of 7zm1A
5jzsB Hsad bound to 3,5-dichloro-4-hydroxybenzoic acid (see paper)
36% identity, 85% coverage: 32:274/285 of query aligns to 33:281/284 of 5jzsB
5jz9A Crystal structure of hsad bound to 3,5-dichloro-4- hydroxybenzenesulphonic acid (see paper)
36% identity, 85% coverage: 32:274/285 of query aligns to 33:281/284 of 5jz9A
>GFF4093 FitnessBrowser__Marino:GFF4093
MNAPVESPEIGREINAAGYSTNLHDLGEGFPVMMIHGSGPGVTAWANWRLVMPELARNRR
VIAPDMLGFGYSERPADQTYNRERWVKHAIGVLDELGLEQVDLVGNSFGGGLALALAIEH
PQRVRRLVLMGSVGVSFPITQGLDEVWGYEPSLDTMRRLMDVFAYDKSLLTEELAQMRYQ
ASVRAGFQESFSAMFPAPRQRWVDNLASKEEDIRALPHETLILHGREDEVIPLEASLKLA
ELINRAQLHVFGRCGHWTQIEHASRFARLVNDFLSEADQAATGGN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory