Comparing GFF4098 FitnessBrowser__Marino:GFF4098 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
Q01468 2-hydroxymuconate tautomerase; 4-oxalocrotonate tautomerase; 4-OT; EC 5.3.2.6 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
75% identity, 100% coverage: 1:63/63 of query aligns to 1:63/63 of Q01468
5tigA Crystal structure of 4-oxalocrotonate tautomerase inactivated by brhpd (see paper)
74% identity, 98% coverage: 2:63/63 of query aligns to 1:62/62 of 5tigA
1bjpA Crystal structure of 4-oxalocrotonate tautomerase inactivated by 2- oxo-3-pentynoate at 2.4 angstroms resolution (see paper)
74% identity, 98% coverage: 2:63/63 of query aligns to 1:62/62 of 1bjpA
6bgnA Crystal structure of 4-oxalocrotonate tautomerase after incubation with 5-fluoro-2-hydroxy-2,4-pentadienoate (see paper)
76% identity, 94% coverage: 2:60/63 of query aligns to 1:59/59 of 6bgnA
6ghwC Substituting the prolines of 4-oxalocrotonate tautomerase with non- canonical analogue (2s)-3,4-dehydroproline (see paper)
77% identity, 90% coverage: 2:58/63 of query aligns to 1:57/57 of 6ghwC
5cloM Crystal structure of a 4-oxalocrotonate tautomerase mutant in complex with nitrostyrene at 2.3 angstrom (see paper)
74% identity, 90% coverage: 2:58/63 of query aligns to 1:57/57 of 5cloM
P70994 2-hydroxymuconate tautomerase; (2Z,4E)-2-hydroxyhexa-2,4-dienedioate keto-enol isomerase; 4-oxalocrotonate tautomerase; 4-OT; EC 5.3.2.6 from Bacillus subtilis (strain 168) (see paper)
41% identity, 89% coverage: 1:56/63 of query aligns to 1:56/62 of P70994
2opaA Ywhb binary complex with 2-fluoro-p-hydroxycinnamate
40% identity, 87% coverage: 2:56/63 of query aligns to 1:55/61 of 2opaA
Sites not aligning to the query:
>GFF4098 FitnessBrowser__Marino:GFF4098
MPVAQINILEGRSDEQKEMLIREVTDAISRSLGAPVESVRIIITEMPKQHFGIGGQSAKK
LGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory