Comparing GFF4109 FitnessBrowser__WCS417:GFF4109 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7bw9A Crystal structure of serine acetyltransferase isoform 3 in complex with cysteine from entamoeba histolytica
39% identity, 49% coverage: 43:204/330 of query aligns to 101:252/280 of 7bw9A
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
38% identity, 50% coverage: 44:208/330 of query aligns to 83:237/272 of 3gvdI
3p47A Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-cysteine (see paper)
37% identity, 52% coverage: 43:212/330 of query aligns to 103:270/270 of 3p47A
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
37% identity, 53% coverage: 46:220/330 of query aligns to 78:247/257 of 1ssqD
3q1xA Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-serine (see paper)
37% identity, 51% coverage: 43:210/330 of query aligns to 101:266/267 of 3q1xA
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
38% identity, 52% coverage: 36:208/330 of query aligns to 74:233/243 of 4n69A
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
36% identity, 52% coverage: 44:215/330 of query aligns to 80:246/262 of 1t3dA
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
37% identity, 51% coverage: 42:210/330 of query aligns to 79:237/261 of 6wyeA
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
37% identity, 51% coverage: 42:210/330 of query aligns to 77:235/243 of 7ra4A
8i04A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with serine (see paper)
36% identity, 52% coverage: 44:215/330 of query aligns to 76:242/258 of 8i04A
8i09A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with butyl gallate (see paper)
36% identity, 52% coverage: 44:215/330 of query aligns to 79:245/246 of 8i09A
8i06A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with coa (see paper)
36% identity, 52% coverage: 44:213/330 of query aligns to 80:244/244 of 8i06A
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
35% identity, 54% coverage: 42:220/330 of query aligns to 74:247/258 of 4h7oA
Sites not aligning to the query:
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
37% identity, 52% coverage: 36:205/330 of query aligns to 70:220/233 of 4n6bA
Sites not aligning to the query:
1sstA Serine acetyltransferase- complex with coa (see paper)
36% identity, 51% coverage: 46:213/330 of query aligns to 78:233/233 of 1sstA
4hzdA Crystal structure of serine acetyltransferase in complex with coenzyme a from brucella abortus strain s19 (see paper)
34% identity, 51% coverage: 48:215/330 of query aligns to 84:246/250 of 4hzdA
Q97R46 Bifunctional protein GlmU; EC 2.7.7.23; EC 2.3.1.157 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see 2 papers)
38% identity, 23% coverage: 132:206/330 of query aligns to 351:432/459 of Q97R46
Sites not aligning to the query:
1g97A S.Pneumoniae glmu complexed with udp-n-acetylglucosamine and mg2+ (see paper)
38% identity, 23% coverage: 132:206/330 of query aligns to 350:431/446 of 1g97A
Sites not aligning to the query:
4aawA S.Pneumoniae glmu in complex with an antibacterial inhibitor (see paper)
37% identity, 23% coverage: 132:206/330 of query aligns to 347:428/455 of 4aawA
Sites not aligning to the query:
7kr9A Bifunctional enzyme glmu bound to zn(ii) (see paper)
37% identity, 23% coverage: 132:206/330 of query aligns to 345:426/453 of 7kr9A
Sites not aligning to the query:
>GFF4109 FitnessBrowser__WCS417:GFF4109
MGGFIDMQQLHDELLTHLIKTLTPAQMKQLEPHLAPLIQNAAQAVAEDLIAYAYRDPASR
GRGDLILESYASFKAVLYYRLAHLVWHFPNQTNSVFSRIALKLSNQGKVLSGAEIHPAAR
IGRRFVLDHGYGTVIGETCEIGNDCYILCGVTLGARGIANNPDGKRHPRLGNNVEVGSGA
RVLGYVLIGDNVFISPSCVITQDVPAGTKVKVVNQIQLQKNDESDHSNYLGAFALEERLH
VVGEINASHKVTVLDADFHPLPGLMLEPTVKERHHLQFRLHRVESGSHLPRLPLNLKVCG
PEFEITLLSPPGLSAMVRSLLQASPLIVGG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory