Comparing GFF4124 FitnessBrowser__Marino:GFF4124 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
31% identity, 56% coverage: 60:204/257 of query aligns to 85:234/296 of P68183
P94530 Arabinooligosaccharides transport system permease protein AraQ from Bacillus subtilis (strain 168) (see paper)
27% identity, 57% coverage: 42:187/257 of query aligns to 58:202/281 of P94530
>GFF4124 FitnessBrowser__Marino:GFF4124
MMTKWLPRTYLTLVYLLLYVPIVVLVVFSFNESRTGYAWGGLSLRWYESLFNNRAMVTAM
WNSLWLALSAATVSTVIGALTALALHRYRFRGKKLLNGMLFVVMMSPEIVLAISLLALFL
LVGLQLGYVSLLLAHVTFCLPFVVITVMARLSGFDESLPEAARDLGASDFTMTRTVLIPV
IMPALLAGWLLGFTLSLDDVVVSTFVSGPSYEILPLRIYSMVRVGLKPEVNALGTLLLVF
SLVMLMLSQWILIRSKR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory