SitesBLAST
Comparing GFF4129 FitnessBrowser__WCS417:GFF4129 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ocrB NADPH and fructose-6-phosphate bound to the dehydrogenase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
27% identity, 92% coverage: 10:219/229 of query aligns to 8:216/675 of 7ocrB
Sites not aligning to the query:
- binding fructose -6-phosphate: 362, 403, 508, 513, 516, 587, 590, 594, 595, 601
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 244, 246, 247, 248, 273, 274, 329, 330, 333, 361, 362, 406, 587, 590
7ocqB Nadh bound to the dehydrogenase domain of the bifunctional mannitol-1- phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
27% identity, 92% coverage: 10:219/229 of query aligns to 8:217/679 of 7ocqB
Sites not aligning to the query:
- binding 1,4-dihydronicotinamide adenine dinucleotide: 245, 246, 247, 248, 249, 274, 275, 329, 330, 334, 363, 403, 405, 407, 591, 594
Q8VZ10 Protein SUPPRESSOR OF QUENCHING 1, chloroplastic; EC 3.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 82% coverage: 9:195/229 of query aligns to 72:260/1055 of Q8VZ10
- D80 (= D17) mutation to N: Complete rescue in complementation test of the nonphotochemical quenching (NPQ) phenotype observed in disrupted plants.
Sites not aligning to the query:
- 431:434 CINC→SINS: No rescue in complementation test of the nonphotochemical quenching (NPQ) phenotype observed in disrupted plants.
- 859 E→K: In soq1-2; high light intensity-dependent and irreversible nonphotochemical quenching (NPQ) due to a decrease in chlorophyll excited-state lifetime.
7ocnA Crystal structure of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
28% identity, 92% coverage: 10:219/229 of query aligns to 8:222/690 of 7ocnA
7ocpA NADPH bound to the dehydrogenase domain of the bifunctional mannitol- 1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
28% identity, 92% coverage: 10:219/229 of query aligns to 8:222/688 of 7ocpA
Sites not aligning to the query:
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 250, 251, 253, 254, 279, 280, 334, 335, 336, 339, 369, 370
7ocqA Nadh bound to the dehydrogenase domain of the bifunctional mannitol-1- phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
28% identity, 92% coverage: 10:219/229 of query aligns to 8:222/686 of 7ocqA
Sites not aligning to the query:
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(3-aminocarbonyl-4~{H}-pyridin-1-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{R},5~{R})-3,4,5-tris(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: 252, 253, 254, 279, 280, 335, 369, 370
4c4sA Structure of beta-phosphoglucomutase in complex with an alpha- fluorophosphonate analogue of beta-glucose-1-phosphate and magnesium trifluoride (see paper)
33% identity, 80% coverage: 12:195/229 of query aligns to 3:185/215 of 4c4sA
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S111 (≠ T116), A112 (≠ S117), K142 (= K152), E166 (= E176), D167 (= D177)
- binding (1R)-1,5-anhydro-1-[(S)-fluoro(phosphono)methyl]-D-glucitol: D10 (= D19), H20 (≠ Y29), W24 (≠ T33), L44 (≠ I52), G46 (= G54), V47 (≠ R55), R49 (≠ A57), S113 (= S118)
- binding magnesium ion: D8 (= D17), D10 (= D19), D167 (= D177)
- binding trifluoromagnesate: D8 (= D17), L9 (≠ M18), D10 (= D19), S111 (≠ T116), A112 (≠ S117), K142 (= K152)
2wf9A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, and beryllium trifluoride, crystal form 2 (see paper)
32% identity, 80% coverage: 12:195/229 of query aligns to 3:188/221 of 2wf9A
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding beryllium trifluoride ion: D8 (= D17), L9 (≠ M18), D10 (= D19), S114 (≠ T116), A115 (≠ S117), K145 (= K152)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D19), H20 (≠ Y29), G46 (= G54), V47 (≠ R55), R49 (≠ A57), S116 (= S118), K117 (≠ S119), N118 (≠ R120)
- binding 6-O-phosphono-alpha-D-glucopyranose: D10 (= D19), H20 (≠ Y29), G46 (= G54), V47 (≠ R55), R49 (≠ A57), A115 (≠ S117), S116 (= S118), K117 (≠ S119), N118 (≠ R120)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
1o03A Structure of pentavalent phosphorous intermediate of an enzyme catalyzed phosphoryl transfer reaction observed on cocrystallization with glucose 6-phosphate (see paper)
32% identity, 80% coverage: 12:195/229 of query aligns to 3:188/221 of 1o03A
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: D8 (= D17), L9 (≠ M18), D10 (= D19), H20 (≠ Y29), G46 (= G54), V47 (≠ R55), R49 (≠ A57), S114 (≠ T116), A115 (≠ S117), S116 (= S118), K117 (≠ S119), K145 (= K152)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
1lvhA The structure of phosphorylated beta-phosphoglucomutase from lactoccocus lactis to 2.3 angstrom resolution (see paper)
32% identity, 80% coverage: 12:195/229 of query aligns to 3:188/221 of 1lvhA
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
7ocsA Mannitol-1-phosphate bound to the phosphatase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld-d16a from acinetobacter baumannii (see paper)
28% identity, 92% coverage: 10:219/229 of query aligns to 8:222/682 of 7ocsA
- binding D-Mannitol-1-phosphate: M16 (= M18), D17 (= D19), E24 (= E26), R27 (≠ Y29), L31 (≠ T33), C51 (≠ A67), L52 (= L68), L54 (= L70), T117 (≠ S117), S118 (= S118), K150 (= K152)
Sites not aligning to the query:
7ocsC Mannitol-1-phosphate bound to the phosphatase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld-d16a from acinetobacter baumannii (see paper)
28% identity, 92% coverage: 10:219/229 of query aligns to 8:222/572 of 7ocsC
- binding D-Mannitol-1-phosphate: M16 (= M18), D17 (= D19), E24 (= E26), R27 (vs. gap), L31 (≠ V32), C51 (≠ I52), L52 (≠ I53), G53 (= G54), L54 (≠ R55), R77 (≠ E79), T117 (= T116), S118 (= S117), K150 (= K152)
5olwA 5-fluorotryptophan labeled beta-phosphoglucomutase in an open conformation (see paper)
32% identity, 80% coverage: 12:195/229 of query aligns to 3:188/224 of 5olwA
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding calcium ion: D8 (= D17), D10 (= D19), P89 (≠ K91), V92 (≠ G94), E124 (≠ H130), N127 (≠ E132), E169 (= E176), D170 (= D177), S171 (= S178)
6h91A Phosphorylated beta-phosphoglucomutase from lactococcus lactis in an open conformer to 2.4 a
32% identity, 80% coverage: 12:195/229 of query aligns to 3:188/218 of 6h91A
4c4rA Structure of beta-phosphoglucomutase in complex with a phosphonate analogue of beta-glucose-1-phosphate and magnesium trifluoride (see paper)
32% identity, 80% coverage: 12:195/229 of query aligns to 3:188/218 of 4c4rA
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
- binding trifluoromagnesate: D8 (= D17), L9 (≠ M18), D10 (= D19), S114 (≠ T116), A115 (≠ S117), K145 (= K152)
- binding (1R)-1,5-anhydro-1-(phosphonomethyl)-D-glucitol: D10 (= D19), H20 (≠ Y29), W24 (≠ T33), L44 (≠ I52), G46 (= G54), V47 (≠ R55), R49 (≠ A57), S52 (≠ L60), S116 (= S118), K117 (≠ S119)
3zi4A The structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate and scandium tetrafluoride
32% identity, 80% coverage: 12:195/229 of query aligns to 3:188/218 of 3zi4A
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D19), H20 (≠ Y29), G46 (= G54), V47 (≠ R55), R49 (≠ A57), S116 (= S118), K117 (≠ S119)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
- binding Scandium Tetrafluoride: D8 (= D17), L9 (≠ M18), D10 (= D19), S114 (≠ T116), A115 (≠ S117), K145 (= K152)
2wf8A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, glucose-1-phosphate and beryllium trifluoride (see paper)
32% identity, 80% coverage: 12:195/229 of query aligns to 3:188/218 of 2wf8A
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding beryllium trifluoride ion: D8 (= D17), L9 (≠ M18), D10 (= D19), S114 (≠ T116), A115 (≠ S117), K145 (= K152)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D19), H20 (≠ Y29), G46 (= G54), V47 (≠ R55), R49 (≠ A57), A115 (≠ S117), S116 (= S118), K117 (≠ S119)
- binding 1-O-phosphono-alpha-D-glucopyranose: D10 (= D19), H20 (≠ Y29), W24 (≠ T33), L44 (≠ I52), G46 (= G54), V47 (≠ R55), R49 (≠ A57), S52 (≠ L60), A115 (≠ S117), S116 (= S118), K117 (≠ S119)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
2wf7A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphonate and aluminium tetrafluoride (see paper)
32% identity, 80% coverage: 12:195/229 of query aligns to 3:188/218 of 2wf7A
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding tetrafluoroaluminate ion: D8 (= D17), L9 (≠ M18), D10 (= D19), S114 (≠ T116), K145 (= K152)
- binding 6,7-dideoxy-7-phosphono-beta-D-gluco-heptopyranose: D10 (= D19), G46 (= G54), V47 (≠ R55), R49 (≠ A57), S116 (= S118), K117 (≠ S119), N118 (≠ R120)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
2wf6A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate and aluminium tetrafluoride (see paper)
32% identity, 80% coverage: 12:195/229 of query aligns to 3:188/218 of 2wf6A
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding tetrafluoroaluminate ion: D8 (= D17), L9 (≠ M18), D10 (= D19), S114 (≠ T116), K145 (= K152)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D19), G46 (= G54), V47 (≠ R55), R49 (≠ A57), S116 (= S118), K117 (≠ S119)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
2wf5A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate and trifluoromagnesate (see paper)
32% identity, 80% coverage: 12:195/229 of query aligns to 3:188/218 of 2wf5A
- active site: D8 (= D17), L9 (≠ M18), D10 (= D19), T16 (= T25), K45 (≠ I53), S114 (≠ T116), A115 (≠ S117), K145 (= K152), E169 (= E176), D170 (= D177)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D19), H20 (≠ Y29), G46 (= G54), V47 (≠ R55), R49 (≠ A57), A115 (≠ S117), S116 (= S118)
- binding magnesium ion: D8 (= D17), D10 (= D19), D170 (= D177)
- binding trifluoromagnesate: D8 (= D17), L9 (≠ M18), D10 (= D19), S114 (≠ T116), A115 (≠ S117), K145 (= K152)
Query Sequence
>GFF4129 FitnessBrowser__WCS417:GFF4129
MNAPRTAVGPIKAVIFDMDGLLLDTEGIYTEVTQIIAERYGRTYDWGIKQHIIGRGAQDL
ADYVVKALDLPITPAQFLEIREPLMSERFPKALGMPGAEALVRHLKAHNIPIAVGTSSSR
NSFGHKTTLHREWFGLFDTIVTADDPEVGAAKPAPDIFLTAARRLGVAPEDCLVFEDSPF
GVTAAKAAHMTAIAVPDEAMADSKYHHADQIIRKLADFDLAAYGLPPRP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory