SitesBLAST
Comparing GFF4142 FitnessBrowser__WCS417:GFF4142 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8pf8A Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
57% identity, 98% coverage: 5:705/715 of query aligns to 15:728/729 of 8pf8A
- binding [2-methyl-5-(trifluoromethyl)pyrazol-3-yl]boronic acid: G76 (= G66), F169 (≠ L159), N173 (≠ K163), S177 (≠ Y167), I193 (≠ A182), F313 (≠ W295)
- binding bis[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]-bis(oxidanyl)boranuide: M39 (= M29), N40 (= N30), E41 (≠ G31), T81 (≠ E71), D92 (= D82), V93 (≠ F83)
- binding [(2~{R})-2,3-bis(oxidanyl)propoxy]-[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]borinic acid: M39 (= M29), G77 (= G67), D78 (= D68), M82 (≠ L72), V93 (≠ F83)
- binding (2~{R})-3-bis[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]boranyloxypropane-1,2-diol: T152 (= T142), R184 (≠ K173), A311 (≠ T293), F312 (= F294), I673 (≠ V656)
Sites not aligning to the query:
8oquA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-92
57% identity, 98% coverage: 5:705/715 of query aligns to 16:729/730 of 8oquA
- binding 4-chloranylbenzenesulfonic acid: M40 (= M29), N41 (= N30), E42 (≠ G31), G77 (= G66), G78 (= G67), D79 (= D68), V80 (≠ L69), D90 (≠ H79), V94 (≠ F83), L124 (= L113), G125 (= G114), P150 (= P139), E151 (= E140)
8oqtA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-91
57% identity, 98% coverage: 5:705/715 of query aligns to 15:728/729 of 8oqtA
- binding 4-bromanylbenzenesulfonic acid: E41 (≠ G31), G76 (= G66), G77 (= G67), D78 (= D68), V79 (≠ L69), M82 (≠ L72), D89 (≠ H79), V93 (≠ F83), T96 (≠ S86), T96 (≠ S86), P149 (= P139), E150 (= E140)
Sites not aligning to the query:
8oqnA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-53
57% identity, 98% coverage: 5:705/715 of query aligns to 15:728/729 of 8oqnA
- binding 1-benzyl-1H-pyrazole-4-carboxylic acid: M39 (= M29), M82 (≠ L72), E150 (= E140), Q172 (≠ E162), F175 (≠ L165), V176 (≠ P166), Q181 (≠ E170), T241 (= T224), F254 (≠ A237), N257 (≠ I240), Q261 (≠ K244), L262 (≠ T245), P266 (vs. gap), P268 (= P250), Q282 (= Q264), V283 (= V265), G302 (= G284), Q303 (= Q285), V304 (= V286), S521 (= S503), G525 (= G507)
8opvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with resveratrol (fragment-b-h11)
57% identity, 98% coverage: 5:705/715 of query aligns to 15:728/729 of 8opvA
- binding resveratrol: M39 (= M29), A75 (= A65), G76 (= G66), M82 (≠ L72), E128 (= E118), P149 (= P139), E150 (= E140), T152 (= T142), L153 (= L143), R184 (≠ K173), F296 (= F278)
8opuA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
57% identity, 98% coverage: 5:705/715 of query aligns to 15:728/729 of 8opuA
8oqrA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-80
57% identity, 98% coverage: 5:705/715 of query aligns to 15:728/728 of 8oqrA
- binding 4-cyanobenzenesulfonic acid: G76 (= G66), G77 (= G67), T81 (≠ E71), M82 (≠ L72), M82 (≠ L72), A85 (≠ V75), D89 (≠ H79), T96 (≠ S86), L123 (= L113), G124 (= G114), P149 (= P139), E150 (= E140), S366 (≠ N348), L367 (= L349), E368 (≠ A350), A420 (= A402), V421 (= V403), F422 (= F404)
4b3iA Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
57% identity, 98% coverage: 5:705/715 of query aligns to 17:730/731 of 4b3iA
- active site: G79 (= G67), E100 (≠ R88), R104 (≠ A92), G127 (= G115), E130 (= E118), P151 (= P139), E152 (= E140), G160 (= G148), S452 (= S432), H473 (= H453), E485 (= E465), S523 (= S503)
- binding adenosine-5'-diphosphate: Q640 (≠ R621), P641 (≠ I622), P642 (≠ S623), L643 (≠ P624), Q644 (= Q625)
- binding coenzyme a: T38 (≠ A26), V40 (≠ T28), A77 (= A65), G79 (= G67), D80 (= D68), V81 (≠ L69), E152 (= E140), F315 (≠ W295), Q319 (≠ N299)
8oqoA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
57% identity, 98% coverage: 5:705/715 of query aligns to 14:727/727 of 8oqoA
8oqsB Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83
57% identity, 98% coverage: 5:705/715 of query aligns to 21:734/735 of 8oqsB
- binding 4-phenylbenzenesulfonic acid: M45 (= M29), I50 (≠ R34), G82 (= G66), G83 (= G67), D84 (= D68), T87 (≠ E71), T87 (≠ E71), M88 (≠ L72), M88 (≠ L72), A91 (≠ V75), D95 (≠ H79), D98 (= D82), V99 (≠ F83), T102 (≠ S86), T102 (≠ S86), E134 (= E118), E156 (= E140), L159 (= L143), F302 (= F278), F302 (= F278), F319 (≠ W295), S456 (= S432), T457 (= T433), M485 (= M461), P486 (= P462), G523 (= G499), S527 (= S503), N535 (= N511), P560 (= P536), M575 (= M551), I578 (= I554), I578 (= I554), I682 (= I659), M683 (≠ F660), G686 (= G663)
Sites not aligning to the query:
8oqlA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
57% identity, 98% coverage: 5:705/715 of query aligns to 14:727/728 of 8oqlA
- binding Hexafluorophosphate anion: V37 (≠ T28), N39 (= N30), G75 (= G66), D77 (= D68), M81 (≠ L72), V92 (≠ F83), T95 (≠ S86), P148 (= P139), E149 (= E140), L152 (= L143), Q180 (≠ E170), Q260 (≠ K244), K362 (= K345), D363 (= D346), V364 (≠ I347), V430 (= V413), D476 (= D459), K477 (= K460), M478 (= M461), P479 (= P462), K506 (= K489)
- binding formamide: V78 (≠ L69), K79 (≠ N70)
8oqvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-109
57% identity, 98% coverage: 5:705/715 of query aligns to 13:726/726 of 8oqvA
- binding 4-nitrobenzenesulfonic acid: E39 (≠ G31), G74 (= G66), M80 (≠ L72), V91 (≠ F83), T94 (≠ S86), T94 (≠ S86), E148 (= E140), L151 (= L143), R182 (≠ K173), S448 (= S432), S519 (= S503), R520 (= R504), L562 (≠ V546), L566 (= L550), I570 (= I554)
Sites not aligning to the query:
8oqqA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-79
57% identity, 98% coverage: 5:705/715 of query aligns to 9:722/723 of 8oqqA
8oqpA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-76
57% identity, 98% coverage: 5:705/715 of query aligns to 9:722/723 of 8oqpA
- binding 2-azanyl-5-sulfo-benzoic acid: G28 (≠ Q24), S29 (= S25), A63 (= A59), K64 (= K60), K64 (= K60), K65 (= K61), P143 (= P139), E144 (= E140), L147 (= L143), F307 (≠ W295), M473 (= M461), P548 (= P536), S599 (≠ M588), L602 (≠ A591), K603 (≠ A592), S661 (= S650), T662 (= T651), G674 (= G663), A698 (≠ N681), R705 (= R688)
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
56% identity, 98% coverage: 5:705/715 of query aligns to 4:710/711 of 7o4uA
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
37% identity, 98% coverage: 12:714/715 of query aligns to 11:702/707 of 6yswA
- active site: A66 (≠ G67), I71 (≠ L72), A84 (≠ V87), Q88 (≠ K91), G112 (= G115), E115 (= E118), P136 (= P139), E137 (= E140), G145 (= G148), D264 (≠ L272), S422 (= S432), H443 (= H453), E455 (= E465), N493 (≠ S503)
- binding coenzyme a: E23 (≠ Q24), M25 (≠ A26), A66 (≠ G67), D67 (= D68), I68 (≠ L69), P136 (= P139), E137 (= E140), L140 (= L143), T290 (≠ L298), K293 (≠ E300)
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
32% identity, 97% coverage: 14:708/715 of query aligns to 49:754/763 of P40939
- V282 (≠ M233) to D: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852773
- I305 (≠ L256) to N: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852774
- L342 (≠ T293) to P: in LCHAD deficiency; dbSNP:rs137852772
- E510 (= E465) active site, For hydroxyacyl-coenzyme A dehydrogenase activity; to Q: in AFLP and LCHAD deficiency; loss of long-chain-3-hydroxyacyl-CoA dehydrogenase activity; dbSNP:rs137852769
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
34% identity, 100% coverage: 3:714/715 of query aligns to 6:705/707 of 1wdmA
- active site: A69 (≠ G67), N89 (≠ V87), N93 (≠ K91), G117 (= G115), E120 (= E118), P139 (= P139), E140 (= E140), P147 (= P147), G148 (= G148), S430 (= S432), H451 (= H453), E463 (= E465), N501 (≠ S503)
- binding acetyl coenzyme *a: K142 (≠ T142), D297 (≠ L298), M459 (= M461), N501 (≠ S503), P534 (= P536), Y652 (≠ F660), L658 (≠ P666)
- binding nicotinamide-adenine-dinucleotide: G321 (= G323), A322 (= A324), I324 (≠ M326), M325 (= M327), D344 (= D346), V401 (= V403), E403 (= E405), N428 (= N430), S430 (= S432), N454 (≠ S456)
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
34% identity, 100% coverage: 3:714/715 of query aligns to 6:713/715 of 1wdlA
- active site: A69 (≠ G67), N89 (≠ V87), N93 (≠ K91), G117 (= G115), E120 (= E118), P139 (= P139), E140 (= E140), P147 (= P147), G148 (= G148), S430 (= S432), H451 (= H453), E463 (= E465), N501 (≠ S503)
- binding nicotinamide-adenine-dinucleotide: A322 (= A324), I324 (≠ M326), M325 (= M327), D344 (= D346), I345 (= I347), A400 (= A402), V401 (= V403), E403 (= E405), N428 (= N430), T429 (= T431), S430 (= S432)
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
34% identity, 100% coverage: 3:714/715 of query aligns to 6:713/715 of P28793
Query Sequence
>GFF4142 FitnessBrowser__WCS417:GFF4142
MTQAIRYEKGQDGIVVLTLDMPGQSANTMNGAYREAMAAMVERLEAQKDDLAGVVITSAK
KTFFAGGDLNELIKVDKAHAKDFYDSVRELKAQLRRLETLGKPVVAAINGAALGGGWEIC
LACHYRVALDDKSVQLGLPEVTLGLLPGGGGVVRMVRMLGLEKALPYLLEGKKVRPQQAL
QAGLVNELAADRDELLAKSRAWILANPDAKQPWDNKGYQIPGGTPSSPKVAQMLAIAPSI
LRSKTQGCFPAPEKILCAAVEGAQVDFDTAHLIETRYFTELVTGQVAKNMIGTFWFQLNE
INAGSSRPQGFAPYVTRKVGVLGAGMMGAGIAYVSASAGIEVVLKDINLAAAEKGKAHSA
ALLDKKVSRGQLTAEQRETFLARIHPTATDEDLAGCDLIIEAVFEDRELKAKVSAAAQSV
VGADAVIASNTSTLPISGLATAVPDQTRFIGLHFFSPVDKMPLVEIIKGARTSDETLARG
FDFVLQIKKTPIVVNDSRGFFTSRVFGTFTNEGIAMLGEGVAAPMIETEARKAGMPVGPL
AVSDEVSLSLMNHIRQQTAKDLQAEGKAVPTHPATAVIDLLVNEYQRMGKAAGGGFYDYP
SGGHKYLWPELKSRFERPDQRISPQDVRDRLLFIQAIETVRCVEEGVLMSTADANVGSIF
GIGFAPWSGGALQFINQYGLNDFIARARYLAEQYGERFMPPALLLEKAAQGDVFR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory