Comparing GFF4143 PS417_21220 acetyl-CoA acetyltransferase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7o4tD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme with coenzyme a bound at the hydratase, thiolase active sites and possible additional binding site (coa(ech/had)) (see paper)
65% identity, 100% coverage: 3:401/401 of query aligns to 4:403/403 of 7o4tD
O53871 Putative acyltransferase Rv0859; EC 2.3.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
65% identity, 100% coverage: 3:401/401 of query aligns to 4:403/403 of O53871
8pf8C Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
65% identity, 100% coverage: 3:401/401 of query aligns to 3:402/402 of 8pf8C
8oqsC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83
65% identity, 100% coverage: 3:401/401 of query aligns to 3:402/402 of 8oqsC
8oqpC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-76
65% identity, 100% coverage: 3:401/401 of query aligns to 3:402/402 of 8oqpC
4b3iC Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
65% identity, 100% coverage: 3:401/401 of query aligns to 3:402/402 of 4b3iC
8oqoC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
65% identity, 100% coverage: 3:401/401 of query aligns to 3:398/398 of 8oqoC
8oqlC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
65% identity, 100% coverage: 3:401/401 of query aligns to 3:397/397 of 8oqlC
8opuC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
65% identity, 100% coverage: 3:401/401 of query aligns to 3:399/399 of 8opuC
8oqmD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-10
65% identity, 100% coverage: 3:401/401 of query aligns to 4:399/399 of 8oqmD
8opyD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-b-dnq
65% identity, 100% coverage: 3:401/401 of query aligns to 4:401/401 of 8opyD
8opxC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with trehalose (fragment-b-tre)
65% identity, 100% coverage: 3:401/401 of query aligns to 3:398/398 of 8opxC
2d3tC Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form v (see paper)
37% identity, 99% coverage: 5:401/401 of query aligns to 8:390/390 of 2d3tC
P07097 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Shinella zoogloeoides (Crabtreella saccharophila) (see 2 papers)
38% identity, 100% coverage: 2:401/401 of query aligns to 3:392/392 of P07097
1ou6A Biosynthetic thiolase from zoogloea ramigera in complex with acetyl-o- pantetheine-11-pivalate
39% identity, 99% coverage: 5:401/401 of query aligns to 6:392/392 of 1ou6A
2vu2A Biosynthetic thiolase from z. Ramigera. Complex with s-pantetheine-11- pivalate. (see paper)
39% identity, 99% coverage: 5:401/401 of query aligns to 3:389/389 of 2vu2A
1dm3A Acetylated biosynthetic thiolase from zoogloea ramigera in complex with acetyl-coa (see paper)
39% identity, 99% coverage: 5:401/401 of query aligns to 3:389/389 of 1dm3A
1dlvA Biosynthetic thiolase from zoogloea ramigera in complex with coa (see paper)
39% identity, 99% coverage: 5:401/401 of query aligns to 3:389/389 of 1dlvA
2vu1A Biosynthetic thiolase from z. Ramigera. Complex of with o-pantheteine- 11-pivalate. (see paper)
39% identity, 99% coverage: 5:401/401 of query aligns to 5:391/391 of 2vu1A
2wkuA Biosynthetic thiolase from z. Ramigera. The n316h mutant. (see paper)
39% identity, 99% coverage: 5:401/401 of query aligns to 3:389/389 of 2wkuA
>GFF4143 PS417_21220 acetyl-CoA acetyltransferase
MTQALIFDAIRTPRGKGKADGALHSVKPVNLVAGLLTALARRSDLDTHQVDDIVLGCVTP
IGDQGADIAKTAALVADWDISVAGVQINRFCASGLEAVNVGAMKVRSGFEDLVVVGGVES
MSRVPMGSDGGAWVLDPQTNMHSHFTPQGIGADLIATLEGFTRDDVDAFALHSQQKAARA
RADGSFNKSLIAVQDQNGIVLLDHDEFIRGDSTLEGLGKLKPSFEMMGQMGFDATALRVY
SHVERIHHVHTPGNSSGIVDGAALMLIGSEAKGRELGLQPRARIVATAVTSTDPTIMLTG
PAPATRKALAKAGLRIEDIDLFEVNEAFASVVLKFIKDMGIDAARVNVNGGSIAMGHPLG
ATGCAILGTLLDELEVRQQRYGLATLCVGGGMGIATIIERL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory