Comparing GFF4155 FitnessBrowser__Marino:GFF4155 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
35% identity, 93% coverage: 1:253/271 of query aligns to 2:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
35% identity, 93% coverage: 1:253/271 of query aligns to 2:253/254 of 1g6hA
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
33% identity, 93% coverage: 2:253/271 of query aligns to 1:235/240 of 6mjpA
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
29% identity, 93% coverage: 3:253/271 of query aligns to 6:238/240 of 1ji0A
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 97% coverage: 6:268/271 of query aligns to 6:255/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 97% coverage: 6:268/271 of query aligns to 6:255/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
31% identity, 97% coverage: 6:268/271 of query aligns to 6:255/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
31% identity, 97% coverage: 6:268/271 of query aligns to 6:255/353 of Q97UY8
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
30% identity, 89% coverage: 2:242/271 of query aligns to 3:229/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
30% identity, 89% coverage: 2:242/271 of query aligns to 3:229/263 of 7d08B
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
30% identity, 89% coverage: 2:242/271 of query aligns to 1:227/253 of 6z5uK
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 90% coverage: 3:246/271 of query aligns to 2:228/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
27% identity, 87% coverage: 6:241/271 of query aligns to 4:223/240 of 4ymuJ
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
29% identity, 93% coverage: 2:253/271 of query aligns to 1:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
29% identity, 93% coverage: 2:253/271 of query aligns to 1:235/238 of 6s8gA
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
27% identity, 96% coverage: 2:262/271 of query aligns to 3:243/285 of 4yerA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
29% identity, 93% coverage: 2:253/271 of query aligns to 1:235/235 of 6mhzA
5x40A Structure of a cbio dimer bound with amppcp (see paper)
33% identity, 86% coverage: 3:236/271 of query aligns to 4:222/280 of 5x40A
6mbnA Lptb e163q in complex with atp (see paper)
29% identity, 93% coverage: 2:253/271 of query aligns to 2:236/241 of 6mbnA
3c4jA Abc protein artp in complex with atp-gamma-s
28% identity, 93% coverage: 1:252/271 of query aligns to 1:238/242 of 3c4jA
>GFF4155 FitnessBrowser__Marino:GFF4155
MSILEISNLSLSFGGVKALQDVSFRVPENTVTTIIGPNGAGKTSLFNCISGFYKPQQGTI
RYQGQTLPGSIKPPKRAALGLARTFQNIALFRGMTVLDNIKLGAHVHMKSGLLSALAYFG
PARREEMAVRKDVEERIIDFLEIDHIRRQPVASLSYGLQKRVELARALAMQPKVLMLDEP
VAGMNREEKEDMARFILDIREEWGVTVLMVEHDMGMVMDISDHIAVLNFGQVITEGLPAD
VQNNPEVIKAYLGNSDIESLRKKLNAEGEAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory