SitesBLAST
Comparing GFF4158 FitnessBrowser__WCS417:GFF4158 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
1efpB Electron transfer flavoprotein (etf) from paracoccus denitrificans (see paper)
66% identity, 97% coverage: 1:242/249 of query aligns to 1:246/246 of 1efpB
- binding adenosine monophosphate: P6 (≠ A6), V7 (= V7), K8 (= K8), D39 (≠ C39), S62 (= S62), I63 (= I63), P98 (≠ S94), V101 (= V97), A119 (≠ L115), G120 (= G116), Q122 (= Q118), A123 (= A119), N126 (≠ S122), M128 (≠ N124), N129 (= N125), A130 (≠ Q126), T131 (= T127)
- binding flavin-adenine dinucleotide: Y13 (= Y13), P37 (= P37), F38 (= F38), L182 (= L178)
P38117 Electron transfer flavoprotein subunit beta; Beta-ETF from Homo sapiens (Human) (see 10 papers)
58% identity, 100% coverage: 1:248/249 of query aligns to 4:255/255 of P38117
- A9 (= A6) binding
- NPFC 39:42 (= NPFC 36:39) binding
- C66 (≠ I63) binding
- 123:134 (vs. 116:127, 83% identical) binding
- D128 (= D121) to N: in GA2B; decreased protein stability; dbSNP:rs104894678
- T154 (≠ E147) to M: in dbSNP:rs1130426
- R164 (= R157) to Q: in GA2B; reduced electron transfer activity; dbSNP:rs104894677
- E165 (= E158) mutation E->A,Q: Drastically increases interprotein electron transfer rates.
- 183:205 (vs. 176:198, 87% identical) Recognition loop
- L195 (= L188) mutation to A: Severely impaired in complex formation with ACADM.
- K200 (= K193) modified: N6,N6,N6-trimethyllysine; by ETFBKMT; alternate; mutation to R: Does not abolish electron transfer activity. Decreases sensitivity to inhibition by lysine methyltransferase ETFBKMT.
- KAK 200:202 (= KAK 193:195) mutation to RAR: Does not abolish methylation by ETFBKMT.
- KAKK 200:203 (= KAKK 193:196) mutation to RAKR: Does not abolish electron transfer activity. Abolishes sensitivity to inhibition by lysine methyltransferase ETFBKMT.
- K203 (= K196) modified: N6,N6,N6-trimethyllysine; by ETFBKMT; mutation to R: Does not abolish electron transfer activity. Decreases sensitivity to inhibition by lysine methyltransferase ETFBKMT.
Q9DCW4 Electron transfer flavoprotein subunit beta; Beta-ETF from Mus musculus (Mouse) (see paper)
59% identity, 100% coverage: 1:248/249 of query aligns to 4:255/255 of Q9DCW4
- K200 (= K193) modified: N6,N6,N6-trimethyllysine; by ETFBKMT; alternate
- K203 (= K196) modified: N6,N6,N6-trimethyllysine; by ETFBKMT
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
2a1uB Crystal structure of the human etf e165betaa mutant (see paper)
58% identity, 100% coverage: 1:248/249 of query aligns to 1:252/252 of 2a1uB
- binding adenosine monophosphate: A6 (= A6), V7 (= V7), K8 (= K8), N36 (= N36), C39 (= C39), S62 (= S62), C63 (≠ I63), P98 (≠ S94), V101 (= V97), L119 (= L115), G120 (= G116), K121 (= K117), Q122 (= Q118), A123 (= A119), D126 (≠ S122), C128 (≠ N124), N129 (= N125), Q130 (= Q126), T131 (= T127)
- binding flavin-adenine dinucleotide: P37 (= P37), F38 (= F38), L182 (= L178)
Q2TBV3 Electron transfer flavoprotein subunit beta; Beta-ETF from Bos taurus (Bovine) (see paper)
57% identity, 100% coverage: 1:248/249 of query aligns to 4:255/255 of Q2TBV3
- K200 (= K193) modified: N6,N6,N6-trimethyllysine; by ETFBKMT; alternate
- K203 (= K196) modified: N6,N6,N6-trimethyllysine; by ETFBKMT
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
P53570 Electron transfer flavoprotein subunit beta; Beta-ETF; Electron transfer flavoprotein small subunit; ETFSS from Methylophilus methylotrophus (Bacterium W3A1) (see paper)
36% identity, 84% coverage: 1:210/249 of query aligns to 1:216/264 of P53570
6fahB Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
31% identity, 98% coverage: 1:243/249 of query aligns to 1:257/262 of 6fahB
- binding flavin-adenine dinucleotide: C6 (≠ A6), A7 (≠ V7), K8 (= K8), D38 (≠ C39), T61 (≠ S62), M62 (≠ I63), A93 (≠ L92), D94 (≠ T93), T95 (≠ S94), T98 (≠ V97), L102 (= L101), A117 (≠ L115), G118 (= G116), Q120 (= Q118), A121 (= A119), G124 (≠ S122), T126 (≠ N124), A127 (≠ N125), Q128 (= Q126), V129 (≠ T127), T223 (≠ N215), V225 (≠ T217)
7koeA Electron bifurcating flavoprotein fix/etfabcx (see paper)
32% identity, 91% coverage: 3:229/249 of query aligns to 4:244/282 of 7koeA
- binding flavin-adenine dinucleotide: C7 (≠ A6), I8 (≠ V7), K9 (= K8), N36 (= N36), D39 (≠ C39), T61 (≠ S62), M62 (≠ I63), A93 (≠ L92), D94 (≠ T93), T95 (≠ S94), T98 (≠ V97), L102 (= L101), T121 (≠ L115), G122 (= G116), Q124 (= Q118), A125 (= A119), D127 (= D121), G128 (≠ S122), T130 (≠ N124), G131 (≠ N125), Q132 (= Q126), V133 (≠ T127), V232 (≠ T217)
1o96A Structure of electron transferring flavoprotein for methylophilus methylotrophus. (see paper)
35% identity, 84% coverage: 1:210/249 of query aligns to 1:215/261 of 1o96A
- binding adenosine monophosphate: A6 (= A6), V7 (= V7), K8 (= K8), N35 (= N36), D38 (≠ C39), S62 (= S62), V63 (≠ I63), V99 (= V97), L103 (= L101), A117 (≠ L115), G118 (= G116), V119 (≠ K117), Q120 (= Q118), S121 (≠ A119), A125 (≠ D123), Y126 (≠ N124), A127 (≠ N125), S128 (≠ Q126), T129 (= T127)
- binding flavin-adenine dinucleotide: W37 (≠ F38), Q120 (= Q118), Q182 (≠ D177)
4l2iB Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
34% identity, 84% coverage: 1:209/249 of query aligns to 1:209/263 of 4l2iB
- binding flavin-adenine dinucleotide: C6 (≠ A6), V7 (= V7), K8 (= K8), P36 (= P37), Y37 (≠ F38), D38 (≠ C39), Y40 (≠ I41), T60 (≠ S62), M61 (≠ I63), A92 (= A89), D93 (≠ E90), T94 (≠ E91), T97 (= T93), M101 (≠ V97), C116 (≠ L115), G117 (= G116), Q119 (= Q118), A120 (= A119), G123 (≠ S122), D124 (= D123), T125 (≠ N124), A126 (≠ N125), Q127 (= Q126), V128 (≠ T127)
- binding nicotinamide-adenine-dinucleotide: M61 (≠ I63), G62 (= G64), P63 (= P65), V84 (= V86), S85 (≠ E87), D86 (≠ S88), R87 (vs. gap), F89 (vs. gap), G90 (vs. gap), G91 (vs. gap), A92 (= A89)
Sites not aligning to the query:
4kpuB Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
34% identity, 84% coverage: 1:209/249 of query aligns to 1:209/263 of 4kpuB
- binding flavin-adenine dinucleotide: C6 (≠ A6), V7 (= V7), K8 (= K8), Y37 (≠ F38), D38 (≠ C39), Y40 (≠ I41), T60 (≠ S62), M61 (≠ I63), A92 (= A89), D93 (≠ E90), T94 (≠ E91), T97 (= T93), M101 (≠ V97), C116 (≠ L115), G117 (= G116), Q119 (= Q118), A120 (= A119), G123 (≠ S122), D124 (= D123), T125 (≠ N124), A126 (≠ N125), Q127 (= Q126), V128 (≠ T127)
Sites not aligning to the query:
5ol2B The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
32% identity, 78% coverage: 1:194/249 of query aligns to 1:194/260 of 5ol2B
- binding flavin-adenine dinucleotide: C6 (≠ A6), I7 (≠ V7), K8 (= K8), D38 (≠ C39), T60 (≠ S62), M61 (≠ I63), A92 (≠ S88), D93 (≠ A89), T94 (≠ E90), T97 (= T93), L101 (≠ V97), A115 (≠ L115), G116 (= G116), R117 (≠ K117), Q118 (= Q118), A119 (= A119), G122 (≠ S122), D123 (= D123), T124 (≠ N124), A125 (≠ N125), Q126 (= Q126), V127 (≠ T127), G128 (= G128)
Sites not aligning to the query:
5ow0B Crystal structure of an electron transfer flavoprotein from geobacter metallireducens (see paper)
29% identity, 81% coverage: 1:202/249 of query aligns to 1:202/251 of 5ow0B
- binding adenosine monophosphate: L6 (≠ A6), A7 (≠ V7), K8 (= K8), D39 (≠ C39), S61 (= S62), Y62 (≠ I63), I95 (≠ A96), L99 (= L100), A114 (≠ L115), G115 (= G116), Q117 (= Q118), S118 (≠ A119), R123 (≠ N124), G124 (≠ N125), V125 (≠ Q126), V126 (≠ T127), P127 (≠ G128)
- binding flavin-adenine dinucleotide: Y13 (= Y13), L37 (vs. gap), Y38 (≠ F38), Q117 (= Q118), S119 (≠ I120)
7qh2B Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
26% identity, 79% coverage: 2:198/249 of query aligns to 3:201/265 of 7qh2B
- binding flavin-adenine dinucleotide: C7 (≠ A6), I8 (≠ V7), K9 (= K8), D39 (≠ C39), S61 (= S62), M62 (≠ I63), A93 (vs. gap), D94 (vs. gap), V95 (vs. gap), T98 (= T93), L102 (≠ V97), C117 (≠ L115), G118 (= G116), K119 (= K117), Q120 (= Q118), T121 (≠ A119), G124 (≠ S122), D125 (= D123), T126 (≠ N124), A127 (≠ N125), Q128 (= Q126), V129 (≠ T127)
Sites not aligning to the query:
Query Sequence
>GFF4158 FitnessBrowser__WCS417:GFF4158
MKVLVAVKRVVDYNVKVRVKADNSGVDLANVKMSMNPFCEIAVEEAVRLKEKGVATEIVV
VSIGPTTAQEQLRTALALGADRAILVESAEELTSLAVAKLLKAVVDKEQPQLVILGKQAI
DSDNNQTGQMLAALTGYGQGTFASKVEVNGDSVAVTREIDGGAQTVSLKLPAIVTTDLRL
NEPRYASLPNIMKAKKKPLESLTPDALGVSTASTNKTVKVEAPAARSAGIKVKSVAELVE
KLKNEAKVI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory