Comparing GFF4159 FitnessBrowser__Marino:GFF4159 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
48% identity, 91% coverage: 2:245/269 of query aligns to 4:239/240 of 1ji0A
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
30% identity, 90% coverage: 3:244/269 of query aligns to 1:235/240 of 6mjpA
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 90% coverage: 4:244/269 of query aligns to 4:253/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
30% identity, 90% coverage: 4:244/269 of query aligns to 4:253/253 of 1g9xB
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
31% identity, 90% coverage: 3:244/269 of query aligns to 1:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
31% identity, 90% coverage: 3:244/269 of query aligns to 1:235/238 of 6s8gA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
31% identity, 90% coverage: 3:244/269 of query aligns to 1:235/235 of 6mhzA
6mbnA Lptb e163q in complex with atp (see paper)
30% identity, 90% coverage: 3:244/269 of query aligns to 2:236/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
31% identity, 90% coverage: 3:243/269 of query aligns to 1:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
31% identity, 90% coverage: 3:243/269 of query aligns to 1:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
30% identity, 89% coverage: 3:242/269 of query aligns to 1:233/233 of 6b8bA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
30% identity, 84% coverage: 17:241/269 of query aligns to 13:235/240 of 4ymuJ
Sites not aligning to the query:
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
28% identity, 83% coverage: 3:226/269 of query aligns to 2:220/229 of 6z67B
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
28% identity, 83% coverage: 3:226/269 of query aligns to 2:220/230 of 6z4wA
6xgyA Crystal structure of e. Coli mlafb abc transport subunits in the dimeric state (see paper)
29% identity, 84% coverage: 20:245/269 of query aligns to 19:243/264 of 6xgyA
Sites not aligning to the query:
7ch6C Cryo-em structure of e.Coli mlafeb with amppnp (see paper)
29% identity, 84% coverage: 20:245/269 of query aligns to 19:243/265 of 7ch6C
Sites not aligning to the query:
7cgnB The overall structure of the mlafedb complex in atp-bound eqtall conformation (mutation of e170q on mlaf) (see paper)
29% identity, 84% coverage: 20:246/269 of query aligns to 19:244/263 of 7cgnB
Sites not aligning to the query:
7mdyC Lolcde nucleotide-bound
33% identity, 75% coverage: 4:204/269 of query aligns to 2:202/226 of 7mdyC
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
33% identity, 75% coverage: 4:204/269 of query aligns to 5:205/233 of P75957
7arlD Lolcde in complex with lipoprotein and adp (see paper)
33% identity, 75% coverage: 4:204/269 of query aligns to 2:202/222 of 7arlD
>GFF4159 FitnessBrowser__Marino:GFF4159
MEALLEIDNIEVVYNKSVQVLRGLSLRVPKGAIVALLGSNGAGKSTTLKSVSGLLTLEDG
EVTAGEVRFRGKDVKGVPPERLVRDGLFHVMEGRRVFEDLTVEENLIAATYALSGSKPSL
SDSYELVYNYFPRLKERRKQLAGYLSGGEQQMLALGRALIAQPDLIMLDEPSLGLAPLLV
EEIFTIVARINREQGTAILLVEQNAAVSLAIASYGYIMENGKIVIDGPADKLTANEDVQE
FYLGVGGKEGEARSYRDIKHYKRRKRWLS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory