Comparing GFF4164 FitnessBrowser__WCS417:GFF4164 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
45% identity, 99% coverage: 4:496/499 of query aligns to 3:494/501 of P04983
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
34% identity, 43% coverage: 6:222/499 of query aligns to 5:224/648 of P75831
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
31% identity, 41% coverage: 18:221/499 of query aligns to 18:225/232 of 1f3oA
Sites not aligning to the query:
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
32% identity, 42% coverage: 21:228/499 of query aligns to 25:232/233 of P75957
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
30% identity, 41% coverage: 18:221/499 of query aligns to 18:225/230 of 1l2tA
Sites not aligning to the query:
7mdyC Lolcde nucleotide-bound
32% identity, 40% coverage: 21:218/499 of query aligns to 22:219/226 of 7mdyC
Sites not aligning to the query:
7arlD Lolcde in complex with lipoprotein and adp (see paper)
32% identity, 40% coverage: 21:218/499 of query aligns to 22:219/222 of 7arlD
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
32% identity, 40% coverage: 21:218/499 of query aligns to 24:221/229 of 7v8iD
Sites not aligning to the query:
Q5M244 Energy-coupling factor transporter ATP-binding protein EcfA2; ECF transporter A component EcfA2; EC 3.6.3.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
31% identity, 40% coverage: 19:220/499 of query aligns to 21:224/280 of Q5M244
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 42% coverage: 9:220/499 of query aligns to 5:215/240 of 4ymuJ
1g291 Malk (see paper)
29% identity, 51% coverage: 4:257/499 of query aligns to 2:258/372 of 1g291
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
27% identity, 51% coverage: 4:255/499 of query aligns to 1:250/363 of 8hprC
8hprD Lpqy-sugabc in state 4 (see paper)
28% identity, 49% coverage: 4:247/499 of query aligns to 1:242/362 of 8hprD
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
31% identity, 41% coverage: 18:220/499 of query aligns to 20:221/592 of 5lj7A
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
31% identity, 41% coverage: 18:220/499 of query aligns to 20:221/615 of 5lilA
Sites not aligning to the query:
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 47% coverage: 6:241/499 of query aligns to 5:254/254 of 1g6hA
7lkpA Structure of atp-free human abca4 (see paper)
26% identity, 52% coverage: 6:262/499 of query aligns to 1631:1886/1941 of 7lkpA
Sites not aligning to the query:
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 43% coverage: 8:220/499 of query aligns to 14:227/265 of P07821
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 47% coverage: 6:240/499 of query aligns to 5:253/253 of 1g9xB
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
27% identity, 50% coverage: 6:256/499 of query aligns to 2:260/343 of P30750
Sites not aligning to the query:
>GFF4164 FitnessBrowser__WCS417:GFF4164
MIGAALRFNGIGKEFPGVKALSQISFEARPREVHALMGENGAGKSTLLKILGGAYLPSSG
TLQIGEQTMDFKSAADSIACGVAVIHQELHLVPEMTVAENLFLGHLPTRFGVVNRSQLRK
QALACLKGLADEIDPDEKLGRLSLGQRQLVEIAKALSRGAHVIAFDEPTSSLSAREIDRL
MAIITRLRDEGKVVLYVSHRMEEVFRICNAVTVFKDGRYVRTFDDMNALSHDQLVTCMVG
RDIQDIYDYRQREQGEVALKVEGLLGPGLREPVSLNVHKGEILGLFGLVGAGRTELFRLL
SGLTRSTAGSLALCGQTLQLRSPRDAIAAGVLLCPEDRKKEGIIPLSSVAENINISARGA
HSTFGWLLRDGWETTNADRQIKAMKVKTPNAEQKIMYLSGGNQQKAILGRWLSMPMKVLL
LDEPTRGIDIGAKSEIYQIIHNLAASGIAVIVVSSDLMEVMGISDRILVMSEGALTGELT
RDQADEARLLQLALPRSRA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory