Comparing GFF4171 FitnessBrowser__WCS417:GFF4171 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
28% identity, 100% coverage: 1:305/305 of query aligns to 1:304/306 of 4xckA
8cqxA Ribokinase from t.Sp mutant a92g
31% identity, 98% coverage: 4:303/305 of query aligns to 2:298/300 of 8cqxA
P0A9J6 Ribokinase; RK; EC 2.7.1.15 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 98% coverage: 4:303/305 of query aligns to 7:305/309 of P0A9J6
1rk2A E. Coli ribokinase complexed with ribose and adp, solved in space group p212121 (see paper)
30% identity, 98% coverage: 4:303/305 of query aligns to 4:302/305 of 1rk2A
1gqtB Activation of ribokinase by monovalent cations (see paper)
30% identity, 98% coverage: 4:303/305 of query aligns to 6:304/307 of 1gqtB
6a8cA Ribokinase from leishmania donovani with adp (see paper)
28% identity, 98% coverage: 4:301/305 of query aligns to 16:324/327 of 6a8cA
6a8bA Ribokinase from leishmania donovani with amppcp (see paper)
28% identity, 98% coverage: 4:301/305 of query aligns to 16:324/327 of 6a8bA
6a8aA Ribokinase from leishmania donovani with atp (see paper)
28% identity, 98% coverage: 4:301/305 of query aligns to 16:324/327 of 6a8aA
3in1A Crystal structure of a putative ribokinase in complex with adp from e.Coli
26% identity, 99% coverage: 4:305/305 of query aligns to 4:310/312 of 3in1A
4n09A Structure of trypanosoma brucei brucei adenosine kinase in complex with adenosine and amppnp (see paper)
26% identity, 84% coverage: 38:294/305 of query aligns to 63:345/345 of 4n09A
Sites not aligning to the query:
3otxA Crystal structure of trypanosoma brucei rhodesiense adenosine kinase complexed with inhibitor ap5a (see paper)
26% identity, 84% coverage: 38:294/305 of query aligns to 60:338/338 of 3otxA
Sites not aligning to the query:
3i3yD Crystal structure of ribokinase in complex with d-ribose from klebsiella pneumoniae
27% identity, 99% coverage: 3:304/305 of query aligns to 2:285/285 of 3i3yD
3ikhA Crystal structure of ribokinase in complex with atp and glycerol in the active site from klebsiella pneumoniae
27% identity, 99% coverage: 3:304/305 of query aligns to 3:286/286 of 3ikhA
2xtbA Crystal structure of trypanosoma brucei rhodesiense adenosine kinase complexed with activator (see paper)
27% identity, 75% coverage: 38:267/305 of query aligns to 64:313/337 of 2xtbA
Sites not aligning to the query:
6znxC Ribokinase from thermus species
30% identity, 98% coverage: 4:303/305 of query aligns to 2:263/265 of 6znxC
7ag6A Crystal structure of sf kinase yihv from e. Coli in complex with sulfofructose (sf), adp-mg (see paper)
25% identity, 98% coverage: 1:300/305 of query aligns to 1:288/302 of 7ag6A
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
27% identity, 79% coverage: 49:290/305 of query aligns to 47:291/308 of 3iq0B
7agkA Crystal structure of e. Coli sf kinase (yihv) in complex with product sulfofructose phosphate (sfp) (see paper)
25% identity, 98% coverage: 1:300/305 of query aligns to 1:288/298 of 7agkA
P32143 Sulfofructose kinase; SF kinase; EC 2.7.1.184 from Escherichia coli (strain K12) (see paper)
25% identity, 98% coverage: 1:300/305 of query aligns to 1:288/298 of P32143
7aghA Crystal structure of sf kinase yihv from e. Coli in complex with amppnp-mg (see paper)
26% identity, 98% coverage: 1:300/305 of query aligns to 1:286/295 of 7aghA
>GFF4171 FitnessBrowser__WCS417:GFF4171
MSRLLHTGQVIVDLVMALDTLPATGGDVLAQSASFEAGGGFNVMAAARRNGLPVVYLGRH
GNGRFGDLARAAMQAEGIEMALAASAGKDTGLCVSLTEATTERTFISHIGAEGELNAEDL
ARVVPQLDDYVYVSGYSLLLEVKAQPLIDWLLALPREIVVVFDPGPLVKAPDSALMRTLL
PRIDIWTSNGPEALAFTGALDIAAALPELSQHLPAETLLVVRDGPNGCWVGRTGSVEHVP
GFKVLAVDSNGAGDAHAGVFIAGLAKGLKPAEAARRANAAAALAVTRWGPATSPGTAEVD
ALLTE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory