Comparing GFF4195 Psest_4268 tripartite ATP-independent periplasmic transporter solute receptor, DctP family to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A3QCW5 C4-dicarboxylate-binding periplasmic protein DctP from Shewanella loihica (strain ATCC BAA-1088 / PV-4) (see paper)
58% identity, 94% coverage: 18:329/331 of query aligns to 25:336/336 of A3QCW5
4p8bA Crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) (see paper)
30% identity, 90% coverage: 30:327/331 of query aligns to 6:310/314 of 4p8bA
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
28% identity, 92% coverage: 26:331/331 of query aligns to 4:310/310 of 7bcrA
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
28% identity, 92% coverage: 26:331/331 of query aligns to 4:310/310 of 7bcpA
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
28% identity, 92% coverage: 26:331/331 of query aligns to 4:310/310 of 7bcoA
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
28% identity, 92% coverage: 26:331/331 of query aligns to 4:310/310 of 7bcnA
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
28% identity, 92% coverage: 26:330/331 of query aligns to 5:310/310 of 7bbrA
P44542 Sialic acid-binding periplasmic protein SiaP; Extracytoplasmic solute receptor protein SiaP; N-acetylneuraminic-binding protein; Neu5Ac-binding protein from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
30% identity, 99% coverage: 1:328/331 of query aligns to 1:328/329 of P44542
Q0B2F6 Solute-binding protein Bamb_6123 from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) (Burkholderia cepacia (strain AMMD)) (see paper)
28% identity, 94% coverage: 2:313/331 of query aligns to 5:312/328 of Q0B2F6
7a5qB Crystal structure of vcsiap bound to sialic acid (see paper)
30% identity, 89% coverage: 28:321/331 of query aligns to 3:293/299 of 7a5qB
7a5qA Crystal structure of vcsiap bound to sialic acid (see paper)
30% identity, 89% coverage: 28:321/331 of query aligns to 3:293/299 of 7a5qA
4magA Crystal structure of the periplasmic sialic acid binding protein from vibrio cholerea (see paper)
30% identity, 91% coverage: 28:329/331 of query aligns to 3:301/307 of 4magA
Sites not aligning to the query:
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
28% identity, 90% coverage: 29:326/331 of query aligns to 4:299/303 of 4pddA
2cexB Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
29% identity, 91% coverage: 29:328/331 of query aligns to 4:304/305 of 2cexB
Sites not aligning to the query:
2v4cA Structure of sialic acid binding protein (siap) in the presence of kdn (see paper)
29% identity, 91% coverage: 29:328/331 of query aligns to 5:305/309 of 2v4cA
2cexA Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
29% identity, 91% coverage: 29:328/331 of query aligns to 4:304/304 of 2cexA
Sites not aligning to the query:
3b50A Structure of h. Influenzae sialic acid binding protein bound to neu5ac. (see paper)
29% identity, 91% coverage: 29:328/331 of query aligns to 5:305/310 of 3b50A
4mnpA Structure of the sialic acid binding protein from fusobacterium nucleatum subsp. Nucleatum atcc 25586 (see paper)
29% identity, 86% coverage: 43:326/331 of query aligns to 18:302/305 of 4mnpA
2wx9A Crystal structure of the sialic acid binding periplasmic protein siap (see paper)
29% identity, 91% coverage: 29:328/331 of query aligns to 5:305/308 of 2wx9A
2xwoA Siap r147e mutant in complex with sialylamide (see paper)
28% identity, 91% coverage: 29:328/331 of query aligns to 5:305/308 of 2xwoA
>GFF4195 Psest_4268 tripartite ATP-independent periplasmic transporter solute receptor, DctP family
MFKLTAKALACALSLSIAGLAHAADPITIKFSHVVAENTPKGQGALMFKKLVEERLAGKV
EVQVYPNSSLFGDGKEMEALLLGDVQLIAPSLAKFEHYSKGVQVYDLPFLFDDIAAVDRF
QKGEAGQSLLRSMEDKNITGLGYWHNGMKQLSANKPLREPKDARGLKFRVQASAVLDEQF
KAVRANPRKMSFAEVYQGLQTGVVNGAENPYSNIYSQKMHEVQKYITESNHGLLDYMVIT
NTKFWNGLPADVRSELESILNEVTVAVNKQADELNQADKQRIVDAGTTEIINLTPEQREM
WREAMKPVWKKFEGEIGADLIKAAEAANQAN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory