SitesBLAST
Comparing GFF4203 FitnessBrowser__Marino:GFF4203 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
36% identity, 95% coverage: 11:263/265 of query aligns to 2:244/244 of 4nbuB
- active site: G18 (= G27), N111 (= N124), S139 (= S152), Q149 (≠ E162), Y152 (= Y165), K156 (= K169)
- binding acetoacetyl-coenzyme a: D93 (≠ F106), K98 (= K111), S139 (= S152), N146 (≠ S159), V147 (≠ S160), Q149 (≠ E162), Y152 (= Y165), F184 (≠ P197), M189 (≠ L202), K200 (≠ A219)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G23), N17 (≠ G26), G18 (= G27), I19 (= I28), D38 (= D47), F39 (≠ R48), V59 (≠ A72), D60 (= D73), V61 (≠ I74), N87 (= N100), A88 (= A101), G89 (= G102), I90 (≠ F103), T137 (≠ V150), S139 (= S152), Y152 (= Y165), K156 (= K169), P182 (= P195), F184 (≠ P197), T185 (= T198), T187 (= T200), M189 (≠ L202)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
36% identity, 94% coverage: 14:263/265 of query aligns to 6:246/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G23), S17 (≠ G25), R18 (≠ G26), I20 (= I28), T40 (≠ R48), N62 (≠ D73), V63 (≠ I74), N89 (= N100), A90 (= A101), I92 (≠ F103), V139 (= V150), S141 (= S152), Y154 (= Y165), K158 (= K169), P184 (= P195), G185 (= G196), I187 (≠ T198), T189 (= T200), M191 (≠ L202)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
36% identity, 94% coverage: 14:263/265 of query aligns to 6:242/243 of 4i08A
- active site: G19 (= G27), N113 (= N124), S141 (= S152), Q151 (≠ E162), Y154 (= Y165), K158 (= K169)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G23), S17 (≠ G25), R18 (≠ G26), I20 (= I28), T40 (≠ R48), N62 (≠ D73), V63 (≠ I74), N89 (= N100), A90 (= A101), G140 (≠ A151), S141 (= S152), Y154 (= Y165), K158 (= K169), P184 (= P195), G185 (= G205), T189 (= T209)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
33% identity, 94% coverage: 14:263/265 of query aligns to 3:243/244 of 6t77A
- active site: G16 (= G27), S138 (= S152), Y151 (= Y165)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G23), S14 (≠ G25), R15 (≠ G26), T37 (≠ R48), L58 (≠ A72), N59 (≠ D73), V60 (≠ I74), A87 (= A101), G88 (= G102), I89 (≠ F103)
4k6fB X-ray crystal structure of a putative acetoacetyl-coa reductase from burkholderia cenocepacia bound to the co-factor NADP
35% identity, 93% coverage: 17:263/265 of query aligns to 2:244/245 of 4k6fB
- active site: G12 (= G27), N102 (≠ L116), S138 (= S152), Y151 (= Y165), K155 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G23), Y32 (≠ D47), S33 (≠ R48), N36 (≠ S51), V58 (≠ A72), D59 (= D73), V60 (≠ I74), A87 (= A101), G88 (= G102), I89 (≠ F103)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
35% identity, 93% coverage: 17:263/265 of query aligns to 5:246/246 of 3osuA
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
35% identity, 95% coverage: 12:263/265 of query aligns to 1:239/239 of 4nbtA
- active site: G16 (= G27), S132 (= S152), Y145 (= Y165), K149 (= K169)
- binding nicotinamide-adenine-dinucleotide: G12 (= G23), K15 (≠ G26), G16 (= G27), L17 (≠ I28), D36 (= D47), L37 (≠ R48), L52 (≠ A72), N53 (≠ D73), V54 (≠ I74), N80 (= N100), A81 (= A101), G82 (= G102), I130 (≠ V150), S132 (= S152), Y145 (= Y165), K149 (= K169), P177 (= P195), G178 (= G196), I180 (≠ T198), T182 (= T200)
5vt6A Crystal structure of acetoacetyl-coa reductase from burkholderia pseudomallei 1710b complexed with NADP
35% identity, 94% coverage: 17:264/265 of query aligns to 2:245/245 of 5vt6A
- active site: G12 (= G27), D102 (≠ L116), S138 (= S152), Y151 (= Y165), K155 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G23), G11 (= G26), G12 (= G27), L13 (≠ I28), H32 (≠ R48), S33 (≠ D49), N36 (≠ T52), V58 (≠ A72), D59 (= D73), V60 (≠ I74), N86 (= N100), A87 (= A101), G88 (= G102), I89 (≠ F103), I136 (≠ V150), Y151 (= Y165), K155 (= K169), P181 (= P195), Y183 (≠ P197), L184 (≠ T198), T186 (= T200)
4cqlI Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD (see paper)
35% identity, 94% coverage: 14:263/265 of query aligns to 6:251/251 of 4cqlI
- active site: G19 (= G27), S146 (= S152), Y159 (= Y165), K163 (= K169)
- binding nicotinamide-adenine-dinucleotide: S18 (≠ G26), G19 (= G27), I20 (= I28), D39 (= D47), L40 (≠ R48), A64 (= A72), D65 (= D73), V66 (≠ I74), C93 (≠ N100), A94 (= A101), G95 (= G102), I96 (≠ F103), V116 (= V123), I144 (≠ V150), S146 (= S152), Y159 (= Y165), K163 (= K169), P189 (= P195), G190 (= G196), I192 (≠ T198), T194 (= T200), M196 (≠ L202)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
36% identity, 94% coverage: 14:263/265 of query aligns to 6:247/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G23), R18 (≠ G26), G19 (= G27), I20 (= I28), D39 (= D47), R40 (= R48), C63 (≠ A72), I65 (= I74), N91 (= N100), G93 (= G102), I94 (≠ F103), V114 (= V123), Y155 (= Y165), K159 (= K169), I188 (≠ T198), T190 (= T200), T193 (≠ L203)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
35% identity, 93% coverage: 17:263/265 of query aligns to 2:239/239 of 3sj7A
- active site: G12 (= G27), S138 (= S152), Q148 (≠ E162), Y151 (= Y165), K155 (= K169)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G23), S10 (≠ G25), R11 (≠ G26), I13 (= I28), N31 (vs. gap), Y32 (≠ L46), A33 (≠ D47), G34 (≠ R48), S35 (≠ D49), A58 (= A72), N59 (≠ D73), V60 (≠ I74), N86 (= N100), A87 (= A101), T109 (≠ V123), S138 (= S152), Y151 (= Y165), K155 (= K169), P181 (= P195), G182 (= G196)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
35% identity, 93% coverage: 14:260/265 of query aligns to 3:244/248 of 4urfB
- active site: G16 (= G27), S142 (= S152), I152 (≠ E162), Y155 (= Y165), K159 (= K169)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (≠ M226), R211 (≠ K227), R212 (= R228)
- binding bicarbonate ion: I92 (≠ F103), G94 (vs. gap), R109 (≠ Q119), R179 (≠ C189), S228 (= S244)
- binding nicotinamide-adenine-dinucleotide: G12 (= G23), G14 (= G25), N15 (≠ G26), G16 (= G27), I17 (= I28), D36 (= D47), I37 (≠ R48), D62 (= D73), T63 (≠ I74), N89 (= N100), A90 (= A101), G91 (= G102), I140 (≠ V150), Y155 (= Y165), K159 (= K169), P185 (= P195), A186 (≠ G196), I188 (≠ T198), T190 (= T200)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
35% identity, 93% coverage: 14:260/265 of query aligns to 3:244/248 of 4urfA
- active site: G16 (= G27), S142 (= S152), I152 (≠ E162), Y155 (= Y165), K159 (= K169)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (≠ F103), S93 (≠ D104), G94 (vs. gap), E95 (≠ R105), T97 (≠ M107), E101 (≠ K111), T103 (≠ E113), Q106 (≠ L116), R109 (≠ Q119), S175 (≠ T185), G177 (≠ N187)
- binding magnesium ion: S237 (≠ Q253), Y238 (≠ V254)
- binding nicotinamide-adenine-dinucleotide: G12 (= G23), G14 (= G25), N15 (≠ G26), G16 (= G27), I17 (= I28), D36 (= D47), I37 (≠ R48), W41 (≠ T52), D62 (= D73), T63 (≠ I74), N89 (= N100), A90 (= A101), G91 (= G102), I140 (≠ V150), Y155 (= Y165), K159 (= K169), P185 (= P195), I188 (≠ T198), T190 (= T200)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
35% identity, 93% coverage: 14:260/265 of query aligns to 3:244/248 of 4ureB
- active site: G16 (= G27), S142 (= S152), I152 (≠ E162), Y155 (= Y165), K159 (= K169)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ G26), G16 (= G27), I17 (= I28), N89 (= N100), G91 (= G102), Y155 (= Y165), P185 (= P195), A186 (≠ G196)
4cqmA Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD and NADP (see paper)
35% identity, 94% coverage: 14:263/265 of query aligns to 4:248/248 of 4cqmA
- active site: G17 (= G27), S143 (= S152), Y156 (= Y165), K160 (= K169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G23), S16 (≠ G26), G17 (= G27), I18 (= I28), D37 (= D47), L38 (≠ R48), A61 (= A72), V63 (≠ I74), C90 (≠ N100), A91 (= A101), G92 (= G102), I93 (≠ F103), V113 (= V123), I141 (≠ V150), S143 (= S152), Y156 (= Y165), K160 (= K169), P186 (= P195), G187 (= G196), I189 (≠ T198), T191 (= T200), P192 (≠ A201), M193 (≠ L202), T194 (≠ L203)
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
33% identity, 94% coverage: 14:263/265 of query aligns to 2:242/243 of 1q7bA
- active site: G15 (= G27), E101 (≠ L116), S137 (= S152), Q147 (≠ E162), Y150 (= Y165), K154 (= K169)
- binding calcium ion: E232 (≠ Q253), T233 (≠ V254)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G23), S13 (≠ G25), R14 (≠ G26), T36 (≠ R48), N58 (≠ D73), V59 (≠ I74), N85 (= N100), A86 (= A101), G87 (= G102), I88 (≠ F103), S137 (= S152), Y150 (= Y165), K154 (= K169), P180 (= P195), G181 (= G196), I183 (≠ T198)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
33% identity, 94% coverage: 14:263/265 of query aligns to 3:243/244 of P0AEK2
- GASR 12:15 (≠ GGGG 23:26) binding
- T37 (≠ R48) binding
- NV 59:60 (≠ DI 73:74) binding
- N86 (= N100) binding
- Y151 (= Y165) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YAACK 165:169) binding
- A154 (≠ C168) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K169) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ T198) binding
- E233 (≠ Q253) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
4ag3A Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) from pseudomonas aeruginosa in complex with NADPH at 1.8a resolution (see paper)
32% identity, 95% coverage: 14:264/265 of query aligns to 10:254/254 of 4ag3A
- active site: G23 (= G27), S148 (= S152), Y161 (= Y165), K165 (= K169)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G19 (= G23), S21 (≠ G25), R22 (≠ G26), G23 (= G27), I24 (= I28), T44 (≠ R48), L68 (≠ A72), D69 (= D73), V70 (≠ I74), N96 (= N100), A97 (= A101), I146 (≠ V150), S148 (= S152), Y161 (= Y165), K165 (= K169), P191 (= P195), G192 (= G196), F193 (≠ P197), I194 (≠ T198), T196 (= T200), M198 (≠ L202), T199 (≠ L203)
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
34% identity, 94% coverage: 14:263/265 of query aligns to 2:242/243 of 7emgB
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
32% identity, 94% coverage: 14:263/265 of query aligns to 2:242/243 of 1q7cA
- active site: G15 (= G27), S137 (= S152), Q147 (≠ E162), F150 (≠ Y165), K154 (= K169)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G23), S13 (≠ G25), R14 (≠ G26), A35 (≠ D47), T36 (≠ R48), L57 (≠ A72), N58 (≠ D73), V59 (≠ I74), G87 (= G102), I88 (≠ F103)
Query Sequence
>GFF4203 FitnessBrowser__Marino:GFF4203
MISQQQEQVIMRGLEGKTVIVTGGGGGIGRAVCLRFAEEGSLVAVLDRDESTARATADLI
TEAGGRAKAYAADITDYAMITDTVAAIESDLGVPTVLVNNAGFDRFMPFLKTEPKLWDQL
IAVNLTGALNMHHVVLPGMIAAGGGKVINVASDAARVGSSGESVYAACKAGLVGFSKTVA
RELATKNVCLNVVCPGPTDTALLKGVAETAPNPEKLLEAFRNAVPMKRLAQPEDYPGLIA
LLASDDANFITGQVISVSGGLTMAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory