SitesBLAST
Comparing GFF4204 FitnessBrowser__Marino:GFF4204 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q4WR83 Acyl-CoA ligase sidI; Siderophore biosynthesis protein I; EC 6.2.1.- from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata) (see paper)
32% identity, 85% coverage: 81:570/578 of query aligns to 66:576/590 of Q4WR83
Sites not aligning to the query:
- 6:14 PTS2-type peroxisomal targeting signal
1md9A Crystal structure of dhbe in complex with dhb and amp (see paper)
29% identity, 94% coverage: 25:565/578 of query aligns to 1:527/536 of 1md9A
- active site: S190 (≠ T229), S210 (≠ N249), H234 (= H273), A333 (≠ T371), E334 (= E372), N434 (≠ I470), K439 (≠ N475), K519 (= K557)
- binding adenosine monophosphate: G191 (≠ S230), G307 (= G345), A308 (= A346), K309 (≠ P347), V329 (≠ A367), F330 (≠ W368), G331 (= G369), M332 (= M370), D413 (= D449), V425 (≠ I461), R428 (= R464), K519 (= K557)
- binding 2,3-dihydroxy-benzoic acid: H234 (= H273), N235 (≠ Q274), Y236 (≠ T275), S240 (≠ Y279), G307 (= G345), V329 (≠ A367), G331 (= G369), M332 (= M370), K519 (= K557)
P40871 2,3-dihydroxybenzoate-AMP ligase; Dihydroxybenzoic acid-activating enzyme; EC 6.2.1.71 from Bacillus subtilis (strain 168) (see paper)
29% identity, 94% coverage: 25:565/578 of query aligns to 1:527/539 of P40871
- G191 (≠ A220) binding
- HN 234:235 (≠ HQ 273:274) binding
- S240 (≠ Y279) binding
- G307 (= G345) binding
- V329 (≠ A367) binding
- D413 (= D449) binding
- R428 (= R464) binding
- K519 (= K557) binding ; binding
5wm2A Crystal structure of cahj in complex with salicylic acid and amp (see paper)
30% identity, 90% coverage: 42:563/578 of query aligns to 21:530/536 of 5wm2A
- active site: S193 (≠ T229), N213 (= N249), H237 (= H273), A336 (≠ T371), E337 (= E372), N437 (≠ I470), K442 (≠ N475), K524 (= K557)
- binding adenosine monophosphate: G310 (= G345), S311 (≠ A346), K312 (≠ P347), V332 (≠ A367), F333 (≠ W368), G334 (= G369), M335 (= M370), A336 (≠ T371), E337 (= E372), D416 (= D449), V428 (≠ I461), K433 (= K466), K442 (≠ N475)
5wm3A Crystal structure of cahj in complex with salicyl adenylate (see paper)
30% identity, 90% coverage: 42:563/578 of query aligns to 21:530/537 of 5wm3A
- active site: S193 (≠ T229), N213 (= N249), H237 (= H273), A336 (≠ T371), E337 (= E372), N437 (≠ I470), K442 (≠ N475), K524 (= K557)
- binding 9-(5-O-{(S)-hydroxy[(2-hydroxybenzene-1-carbonyl)oxy]phosphoryl}-alpha-L-lyxofuranosyl)-9H-purin-6-amine: N238 (≠ Q274), F239 (≠ T275), G310 (= G345), S311 (≠ A346), K312 (≠ P347), V332 (≠ A367), F333 (≠ W368), G334 (= G369), M335 (= M370), A336 (≠ T371), D416 (= D449), K433 (= K466), K442 (≠ N475)
- binding magnesium ion: S301 (≠ D336), L303 (= L338), G326 (≠ K361)
5wm6A Crystal structure of cahj in complex with benzoyl adenylate (see paper)
30% identity, 90% coverage: 42:563/578 of query aligns to 21:530/535 of 5wm6A
- active site: S193 (≠ T229), N213 (= N249), H237 (= H273), A336 (≠ T371), E337 (= E372), N437 (≠ I470), K442 (≠ N475), K524 (= K557)
- binding magnesium ion: S301 (≠ D336), L303 (= L338), G326 (≠ K361)
- binding 5'-O-[(R)-(benzoyloxy)(hydroxy)phosphoryl]adenosine: F239 (≠ T275), G310 (= G345), S311 (≠ A346), K312 (≠ P347), V332 (≠ A367), F333 (≠ W368), G334 (= G369), M335 (= M370), A336 (≠ T371), D416 (= D449), K433 (= K466), K442 (≠ N475)
5wm5A Crystal structure of cahj in complex with 5-methylsalicyl adenylate (see paper)
30% identity, 90% coverage: 42:563/578 of query aligns to 21:528/533 of 5wm5A
- active site: S193 (≠ T229), N213 (= N249), H237 (= H273), A336 (≠ T371), E337 (= E372), N437 (≠ I470), K442 (≠ N475), K522 (= K557)
- binding 9-(5-O-{(S)-hydroxy[(2-hydroxy-5-methylbenzene-1-carbonyl)oxy]phosphoryl}-alpha-L-lyxofuranosyl)-9H-purin-6-amine: H237 (= H273), N238 (≠ Q274), F239 (≠ T275), G309 (≠ A344), G310 (= G345), S311 (≠ A346), K312 (≠ P347), V332 (≠ A367), F333 (≠ W368), G334 (= G369), M335 (= M370), A336 (≠ T371), L340 (≠ V376), D416 (= D449), K433 (= K466), K442 (≠ N475)
P9WQ37 Long-chain-fatty-acid--CoA ligase FadD13; Fatty acyl-CoA ligase; FACL; FACL13; Fatty acyl-CoA synthetase; ACS; FACS; Very-long-chain fatty-acyl-CoA synthetase; ACSVL; EC 6.2.1.3 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 4 papers)
31% identity, 85% coverage: 73:566/578 of query aligns to 25:496/503 of P9WQ37
- K172 (= K237) mutation to A: Slight reduction of the fatty acyl-CoA ligase activity. Slight increase of susceptibility to proteolysis.
- R195 (≠ T260) mutation to A: Alteration of the strength of the membrane binding; when associated with A-9; A-17; A-197 and A-244.
- R197 (≠ D262) mutation to A: Alteration of the strength of the membrane binding; when associated with A-9; A-17; A-195 and A-244.
- V209 (≠ T275) mutation to D: Strong reduction of the fatty acyl-CoA ligase activity. No significant change in the total expression level, however the cytoplasmic expression is reduced. Slight increase of susceptibility to proteolysis.
- A211 (≠ F277) mutation to G: Slight increase of the fatty acyl-CoA ligase activity. Reduced rate of proteolytic degradation.
- T214 (≠ G280) mutation to W: Shows a marked decrease in the activity with lauric and palmitic acid (C12 and C16 fatty acid) with a simultaneous increase in the activity with caprylic acid (C8 fatty acid).
- R244 (≠ K310) mutation to A: Alteration of the strength of the membrane binding; when associated with A-17; A-195; A-195 and A-197.
- A302 (≠ G369) mutation to G: Slight increase of the fatty acyl-CoA ligase activity. Reduced rate of proteolytic degradation.; mutation to W: Does not show activity with small, medium or long acyl chains.
- W377 (= W444) mutation to A: Strong reduction of the fatty acyl-CoA ligase activity. Enhanced affinity towards palmitic acid binding. No significant change in the total expression level, however the cytoplasmic expression is low. Slight increase of susceptibility to proteolysis.
- D382 (= D449) mutation to A: Strong reduction of the fatty acyl-CoA ligase activity. No significant change in the total expression level, however the cytoplasmic expression is reduced.
- R397 (= R464) mutation to A: Reduction of binding affinity for fatty acids.
- S404 (≠ R471) mutation to A: Slight reduction of the fatty acyl-CoA ligase activity. Enhanced affinity towards palmitic acid binding.
- G406 (= G473) mutation to L: No effect on the formation of acyl-adenylate intermediate. However, it shows very poor catalytic efficiency to form acyl-CoA.
- K487 (= K557) mutation to A: Strong reduction of the fatty acyl-CoA ligase activity. Reduction of binding affinity for ATP.
Sites not aligning to the query:
- 9 R→A: Alteration of the strength of the membrane binding; when associated with A-9; A-195; A-197 and A-244.
- 17 R→A: Alteration of the strength of the membrane binding; when associated with A-9; A-17; A-197 and A-244.
5wm4A Crystal structure of cahj in complex with 6-methylsalicyl adenylate (see paper)
29% identity, 89% coverage: 42:557/578 of query aligns to 21:524/534 of 5wm4A
- active site: S193 (≠ T229), N213 (= N249), H237 (= H273), A336 (≠ T371), E337 (= E372), N437 (≠ I470), K442 (≠ N475), K521 (≠ A554)
- binding 9-(5-O-{(S)-hydroxy[(2-hydroxy-6-methylbenzene-1-carbonyl)oxy]phosphoryl}-alpha-L-lyxofuranosyl)-9H-purin-6-amine: N238 (≠ Q274), F239 (≠ T275), C243 (≠ Y279), G309 (≠ A344), G310 (= G345), S311 (≠ A346), K312 (≠ P347), V332 (≠ A367), F333 (≠ W368), G334 (= G369), M335 (= M370), A336 (≠ T371), L340 (≠ V376), D416 (= D449), K433 (= K466), K442 (≠ N475)
- binding magnesium ion: M453 (≠ Y486), H455 (≠ F488), V458 (≠ I491)
P10378 Enterobactin synthase component E; 2,3-dihydroxybenzoate-AMP ligase; DHB-AMP ligase; 2,3-dihydroxybenzoate-AMP synthase; Dihydroxybenzoic acid-activating enzyme; Enterochelin synthase E; EC 6.3.2.14; EC 6.2.1.71 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 94% coverage: 25:565/578 of query aligns to 1:528/536 of P10378
- N235 (≠ Q274) binding
- S240 (≠ Y279) binding
- G309 (= G345) binding
- V331 (≠ A367) binding
- A335 (≠ T371) binding
- D415 (= D449) binding
- K432 (= K466) binding
- R437 (= R471) mutation to D: Catalyzes the adenylation reaction with 10% reduction of activity compared to the wild-type. 3% reduction of activity compared to the wild-type; when associated with D-473.
- GG 438:439 (= GG 472:473) Phosphopantetheine binding
- K441 (≠ N475) binding
- K473 (≠ R507) mutation to D: Catalyzes the adenylation reaction with same activity as the wild-type. 3% reduction of activity compared to the wild-type; when associated with D-437.
- R494 (≠ T531) mutation to D: Catalyzes the adenylation reaction with same activity as the wild-type.
3rg2C Structure of a two-domain nrps fusion protein containing the ente adenylation domain and entb aryl-carrier protein from enterobactin biosynthesis (see paper)
29% identity, 94% coverage: 25:565/578 of query aligns to 1:528/613 of 3rg2C
- active site: S190 (≠ T229), S210 (≠ N249), H234 (= H273), A335 (≠ T371), E336 (= E372), N436 (≠ I470), K441 (≠ N475), K520 (= K557)
- binding 4'-phosphopantetheine: P231 (= P270), V279 (≠ A317), G438 (= G472), G439 (= G473)
- binding 5'-deoxy-5'-({[2-(2-hydroxyphenyl)ethyl]sulfonyl}amino)adenosine: N235 (≠ Q274), Y236 (≠ T275), G309 (= G345), A310 (= A346), R311 (≠ P347), V331 (≠ A367), F332 (≠ W368), G333 (= G369), M334 (= M370), A335 (≠ T371), D415 (= D449), V427 (≠ I461)
6e97B Crystal structure of the aryl acid adenylating enzyme fscc from fuscachelin nrps in complex with dhb-adenylate
29% identity, 91% coverage: 41:566/578 of query aligns to 15:531/537 of 6e97B
- active site: S190 (≠ T229), S210 (≠ N249), H234 (= H273), A336 (≠ T371), E337 (= E372), N437 (≠ I470), K442 (≠ N475), K522 (= K557)
- binding 5'-O-[(S)-[(2,3-dihydroxybenzene-1-carbonyl)oxy](hydroxy)phosphoryl]adenosine: H234 (= H273), N235 (≠ Q274), F236 (≠ Y279), S240 (≠ M283), G310 (= G345), A311 (= A346), K312 (≠ P347), V332 (≠ A367), F333 (≠ W368), G334 (= G369), M335 (= M370), A336 (≠ T371), D416 (= D449), K433 (= K466), K442 (≠ N475)
4iz6A Structure of ente and entb, an nrps adenylation-pcp fusion protein with pseudo translational symmetry (see paper)
29% identity, 91% coverage: 41:565/578 of query aligns to 17:526/609 of 4iz6A
- active site: S189 (= S230), S208 (≠ N249), H232 (= H273), A333 (≠ T371), E334 (= E372), N434 (≠ I470), K439 (≠ N475), K518 (= K557)
- binding 5'-deoxy-5'-({[2-(2,3-dihydroxyphenyl)ethyl]sulfonyl}amino)adenosine: Y234 (≠ T275), S238 (≠ Y279), G307 (= G345), A308 (= A346), R309 (≠ P347), V329 (≠ A367), F330 (≠ W368), G331 (= G369), M332 (= M370), D413 (= D449), K430 (= K466), K439 (≠ N475)
- binding 4'-phosphopantetheine: P229 (= P270), H232 (= H273), V277 (≠ A317), G436 (= G472)
7tz4A Salicylate adenylate pchd from pseudomonas aeruginosa containing 4- cyanosalicyl-ams (see paper)
28% identity, 92% coverage: 40:569/578 of query aligns to 14:529/530 of 7tz4A
- binding 5'-O-[(4-cyano-2-hydroxybenzoyl)sulfamoyl]adenosine: H232 (= H273), N233 (≠ Q274), F234 (≠ Y279), C238 (≠ M283), G305 (= G345), S306 (≠ A346), R307 (≠ P347), V327 (≠ A367), L328 (≠ W368), G329 (= G369), M330 (= M370), A331 (≠ T371), I335 (≠ V376), D411 (= D449), V423 (≠ I461), K517 (= K557)
3r44A Mycobacterium tuberculosis fatty acyl coa synthetase (see paper)
30% identity, 85% coverage: 73:566/578 of query aligns to 28:496/502 of 3r44A
Sites not aligning to the query:
6e8oA Crystal structure of aryl acid adenylating enzyme fscc from fuscachelin nrps in complex with amp
29% identity, 91% coverage: 41:566/578 of query aligns to 15:530/536 of 6e8oA
- active site: S190 (≠ T229), S210 (≠ N249), H234 (= H273), A336 (≠ T371), E337 (= E372), N437 (≠ I470), K442 (≠ N475), K521 (= K557)
- binding adenosine monophosphate: H234 (= H273), G310 (= G345), A311 (= A346), K312 (≠ P347), V332 (≠ A367), F333 (≠ W368), G334 (= G369), M335 (= M370), A336 (≠ T371), D416 (= D449), V428 (≠ I461), K442 (≠ N475)
4gxqA Crystal structure of atp bound rpmatb-bxbclm chimera b1 (see paper)
29% identity, 85% coverage: 78:570/578 of query aligns to 27:504/506 of 4gxqA
- active site: T163 (= T229), N183 (= N249), H207 (= H273), T303 (= T371), E304 (= E372), I403 (= I470), N408 (= N475), A491 (≠ K557)
- binding adenosine-5'-triphosphate: T163 (= T229), S164 (= S230), G165 (= G231), T166 (= T232), T167 (= T233), H207 (= H273), S277 (≠ G345), A278 (= A346), P279 (= P347), E298 (≠ S366), M302 (= M370), T303 (= T371), D382 (= D449), R397 (= R464)
- binding carbonate ion: H207 (= H273), S277 (≠ G345), R299 (≠ A367), G301 (= G369)
6iylA The structure of ente with 3-cyanobenzoyl adenylate analog (see paper)
29% identity, 88% coverage: 41:551/578 of query aligns to 16:512/521 of 6iylA
- active site: S188 (≠ T229), S208 (≠ N249), H232 (= H273), A333 (≠ T371), E334 (= E372), N434 (≠ I470), K439 (≠ N475)
- binding 5'-O-[(3-cyanobenzene-1-carbonyl)sulfamoyl]adenosine: H232 (= H273), Y234 (≠ T275), S238 (≠ Y279), G307 (= G345), A308 (= A346), R309 (≠ P347), V329 (≠ A367), F330 (≠ W368), G331 (= G369), M332 (= M370), A333 (≠ T371), D413 (= D449), V425 (≠ I461), K430 (= K466), K439 (≠ N475)
6iykA The structure of ente with 2-nitrobenzoyl adenylate analog (see paper)
29% identity, 88% coverage: 41:551/578 of query aligns to 16:512/521 of 6iykA
- active site: S188 (≠ T229), S208 (≠ N249), H232 (= H273), A333 (≠ T371), E334 (= E372), N434 (≠ I470), K439 (≠ N475)
- binding 5'-O-[(2-nitrobenzene-1-carbonyl)sulfamoyl]adenosine: H232 (= H273), G233 (≠ Q274), Y234 (≠ T275), G307 (= G345), A308 (= A346), R309 (≠ P347), V329 (≠ A367), F330 (≠ W368), G331 (= G369), M332 (= M370), A333 (≠ T371), D413 (= D449), V425 (≠ I461), K439 (≠ N475)
7tybA Salicylate adenylate pchd from pseudomonas aeruginosa containing salicyl-ams (see paper)
28% identity, 92% coverage: 40:568/578 of query aligns to 13:523/523 of 7tybA
- binding 5'-O-[(2-hydroxybenzoyl)sulfamoyl]adenosine: H227 (= H273), N228 (≠ Q274), F229 (≠ Y279), C233 (≠ M283), G300 (= G345), S301 (≠ A346), R302 (≠ P347), V322 (≠ A367), L323 (≠ W368), G324 (= G369), M325 (= M370), A326 (≠ T371), Q346 (≠ D392), D406 (= D449), V418 (≠ I461), R421 (= R464), K512 (= K557)
Query Sequence
>GFF4204 FitnessBrowser__Marino:GFF4204
MRLDQISASARPFNNKNRNEQVKKMDTGITLNPERRAAMIKSGAWNDKIITDYFDQAVAS
TPDREAIVGYQVTSDTRNALTYRELNDKVTRMAAGLAAMGIGKGEVVACQLPNWWQTTAL
HLACMRIGAILNPLMPIFRERELRFMLKHGEAKLLVIPKVFRDFDYEAMVDGIRGELPAL
ETLLVIGGEGERSFEQRLMETPWEKQQDITSLFAERQLTADDAIQILYTSGTTGEPKGVM
HTSNTLFSNVRPYADRLHLTSDDKVLMASPLAHQTGFMYGIMMPVYLGTTAILQDIWDAD
YVCKVIGAEKPAFTMAATPFLADLVKTAPKHEGELDSLRIFVSAGAPIPSAVVEQAGKVL
KAKIVSAWGMTENGAVTMTCPEDPAERASQSDGKAMPFMEVKVTDFQGNELPAGEEGSLL
VRGSSLFVGYLKRPELYGVDESGWFNTGDLARMDQDAYIRITGRTKDVVIRGGENIPVVE
VENLLYKFPGIVDVALVGCPDERLGERLCAYVTLDENATDLTLEQVKTYLTEQQLSKNYL
PEYLEVIEAMPRTASGKIQKFKLREQARNVRLEPNKHH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory