Comparing GFF4214 FitnessBrowser__psRCH2:GFF4214 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
7d50B Spua mutant - h221n with glutamyl-thioester (see paper)
70% identity, 100% coverage: 1:248/248 of query aligns to 6:255/255 of 7d50B
7d53A Spua mutant - h221n with glu (see paper)
70% identity, 100% coverage: 2:248/248 of query aligns to 1:249/249 of 7d53A
7d4rB Spua native structure (see paper)
62% identity, 97% coverage: 5:245/248 of query aligns to 2:214/215 of 7d4rB
P76038 Gamma-glutamyl-gamma-aminobutyrate hydrolase PuuD; Gamma-Glu-GABA hydrolase; EC 3.5.1.94 from Escherichia coli (strain K12) (see paper)
46% identity, 98% coverage: 1:242/248 of query aligns to 4:245/254 of P76038
6vtvB Crystal structure of puud gamma-glutamyl-gamma-aminobutyrate hydrolase from e. Coli
46% identity, 98% coverage: 1:242/248 of query aligns to 2:243/252 of 6vtvB
3fijA Crystal structure of a uncharacterized protein lin1909
32% identity, 96% coverage: 4:242/248 of query aligns to 2:221/224 of 3fijA
O33341 Putative glutamine amidotransferase Rv2859c; EC 2.4.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 98% coverage: 2:245/248 of query aligns to 63:299/308 of O33341
P49915 GMP synthase [glutamine-hydrolyzing]; GMP synthetase; Glutamine amidotransferase; EC 6.3.5.2 from Homo sapiens (Human) (see paper)
29% identity, 52% coverage: 99:227/248 of query aligns to 92:198/693 of P49915
Sites not aligning to the query:
1vcnA Crystal structure of t.Th. Hb8 ctp synthetase complex with sulfate anion (see paper)
29% identity, 58% coverage: 100:243/248 of query aligns to 353:504/506 of 1vcnA
Sites not aligning to the query:
>GFF4214 FitnessBrowser__psRCH2:GFF4214
MSRKPLIGVSACTRQIGHHSFHIAGDKYLRAAAIAGVPLVIPALDELIDPATLLESFDGL
LFTGSPSNVEPHHYGGPASDAGTHHDPLRDRLTLPLIRAAVEAGIPVFGICRGFQEMNVA
FGGSLHQKVHEAGPYQDHRERPDDPLDVQYGLSHALHVQPGGLLERLGLPAQIQVNSVHG
QGVERLGGGLRIEALAPDGLIEAFSVEQARSFALGVQWHPEWQVHEHPHYLALFRGFAEA
CEARARQR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory