SitesBLAST
Comparing GFF4233 FitnessBrowser__Marino:GFF4233 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6vw7D Formate dehydrogenase fdsabg subcomplex fdsbg from c. Necator - nadh bound (see paper)
65% identity, 99% coverage: 2:510/512 of query aligns to 4:510/514 of 6vw7D
- binding flavin mononucleotide: G154 (= G153), G156 (= G155), K165 (= K164), N182 (= N182), E185 (= E185), G273 (= G273), E274 (= E274), E275 (= E275), N309 (= N309), N310 (= N310), S313 (= S313), A490 (= A490), M491 (= M491)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A158 (= A157), F160 (= F159), K165 (= K164), T168 (= T167), E275 (= E275), L295 (= L295)
- binding iron/sulfur cluster: V271 (≠ I271), V289 (= V289), S442 (= S442), C443 (= C443), G444 (= G444), K445 (= K445), C446 (= C446), C449 (= C449), L488 (= L488), C489 (= C489), M491 (= M491), G492 (= G492)
6tg9B Cryo-em structure of nadh reduced form of NAD+-dependent formate dehydrogenase from rhodobacter capsulatus (see paper)
57% identity, 99% coverage: 4:510/512 of query aligns to 2:492/493 of 6tg9B
- binding flavin mononucleotide: G146 (= G153), R147 (= R154), G148 (= G155), N174 (= N182), D176 (= D184), E177 (= E185), Y254 (= Y270), G257 (= G273), E258 (= E274), N293 (= N309), N294 (= N310), S297 (= S313)
- binding 1,4-dihydronicotinamide adenine dinucleotide: F152 (= F159), K157 (= K164), E258 (= E274), E259 (= E275), L279 (= L295), K466 (≠ V484), L470 (= L488)
- binding iron/sulfur cluster: S426 (= S442), C427 (= C443), G428 (= G444), T429 (≠ K445), C430 (= C446), C433 (= C449), L470 (= L488), C471 (= C489), G474 (= G492)
8oh5B Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
41% identity, 99% coverage: 4:512/512 of query aligns to 2:511/584 of 8oh5B
- binding fe2/s2 (inorganic) cluster: C10 (≠ T12), C41 (≠ S43), C45 (≠ F47)
- binding flavin mononucleotide: R154 (= R154), K164 (= K164), N181 (= N182), F269 (≠ Y270), E273 (= E274), E274 (= E275), I307 (≠ V308), N308 (= N309), N309 (= N310), G489 (≠ A490), L490 (≠ M491)
- binding nicotinamide-adenine-dinucleotide: G155 (= G155), G156 (= G156), F159 (= F159), F163 (≠ I163), E273 (= E274), E274 (= E275), K291 (= K292), F294 (≠ L295), G413 (= G414)
- binding iron/sulfur cluster: P288 (≠ V289), C442 (= C443), G443 (= G444), C445 (= C446), C448 (= C449), C488 (= C489), L490 (≠ M491), G491 (= G492)
- binding zinc ion: C425 (≠ D426)
Sites not aligning to the query:
- binding iron/sulfur cluster: 531, 536, 540, 542, 546, 547, 548, 559, 566, 567, 568, 569, 572
- binding zinc ion: 512, 518, 523
7q4vB Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
42% identity, 93% coverage: 35:512/512 of query aligns to 40:526/599 of 7q4vB
- binding fe2/s2 (inorganic) cluster: C48 (≠ S43), F49 (≠ R44), L51 (= L46), C52 (≠ F47)
- binding flavin mononucleotide: G166 (= G153), G168 (= G155), N196 (= N182), D198 (= D184), F284 (≠ Y270), G287 (= G273), E288 (= E274), E289 (= E275), N324 (= N310)
- binding iron/sulfur cluster: C457 (= C443), G458 (= G444), K459 (= K445), C460 (= C446), C463 (= C449), C503 (= C489), G506 (= G492)
- binding zinc ion: C440 (≠ D426)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 11, 16
- binding iron/sulfur cluster: 544, 551, 552, 553, 554, 555, 556, 557, 561, 562, 574, 581, 583, 584, 585, 586, 587, 591, 593, 595
- binding zinc ion: 527, 533
8a6tB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
45% identity, 82% coverage: 95:512/512 of query aligns to 142:557/630 of 8a6tB
- binding flavin mononucleotide: G201 (= G155), N227 (= N182), E230 (= E185), N355 (= N310), G535 (≠ A490), L536 (≠ M491)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S320 (≠ E275), R337 (≠ K292), R340 (≠ L295), T341 (≠ P296), N342 (≠ A297), S433 (≠ L388)
- binding iron/sulfur cluster: S487 (= S442), C488 (= C443), G489 (= G444), C491 (= C446), C494 (= C449), C534 (= C489), L536 (≠ M491), G537 (= G492)
- binding zinc ion: C471 (≠ D426)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 36, 82, 85, 86
- binding iron/sulfur cluster: 575, 577, 582, 583, 585, 588, 592, 596, 597, 607, 612, 618, 622, 624, 626, 627
- binding zinc ion: 558, 564
7p8nB Tmhydabc- t. Maritima hydrogenase with bridge closed (see paper)
40% identity, 99% coverage: 5:512/512 of query aligns to 28:543/613 of 7p8nB
- binding fe2/s2 (inorganic) cluster: C31 (≠ P8), G33 (≠ D10), T34 (= T11), C36 (≠ A13), C67 (≠ S43), C68 (≠ R44), G69 (= G45), R70 (≠ L46), C71 (≠ F47)
- binding flavin mononucleotide: G185 (= G153), R186 (= R154), G187 (= G155), N213 (= N182), D215 (= D184), E216 (= E185), G217 (= G186), F301 (≠ Y270), G304 (= G273), E305 (= E274), E306 (= E275), N340 (= N309), N341 (= N310), G521 (≠ A490), L522 (≠ M491)
- binding iron/sulfur cluster: P320 (≠ V289), S473 (= S442), C474 (= C443), G475 (= G444), K476 (= K445), C477 (= C446), C480 (= C449), L519 (= L488), C520 (= C489), L522 (≠ M491), G523 (= G492)
- binding zinc ion: C457 (≠ D426)
Sites not aligning to the query:
- binding iron/sulfur cluster: 560, 567, 570, 571, 573, 577, 590, 592, 597, 599, 600, 601, 603, 607
- binding zinc ion: 544, 549, 554
7q4vF Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
46% identity, 77% coverage: 118:512/512 of query aligns to 1:397/470 of 7q4vF
- binding flavin mononucleotide: G37 (= G153), G39 (= G155), N67 (= N182), G158 (= G273), E159 (= E274), E160 (= E275), G375 (≠ A490)
- binding nicotinamide-adenine-dinucleotide: G40 (= G156), F43 (= F159), K48 (= K164), R177 (≠ K292), F180 (≠ L295), M297 (≠ G412)
- binding iron/sulfur cluster: S327 (= S442), C328 (= C443), G329 (= G444), K330 (= K445), C331 (= C446), C334 (= C449), L373 (= L488), C374 (= C489)
- binding zinc ion: C311 (≠ D426)
Sites not aligning to the query:
- binding iron/sulfur cluster: 415, 417, 422, 424, 425, 426, 427, 428, 432, 433, 437, 445, 452, 454, 455, 456, 457, 458, 462, 463, 467
- binding zinc ion: 398, 404, 409
7t30B Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/NAD(h) bound state (see paper)
44% identity, 80% coverage: 103:512/512 of query aligns to 3:412/425 of 7t30B
- binding fe2/s2 (inorganic) cluster: C326 (≠ D426), C364 (≠ R464)
- binding flavin mononucleotide: G54 (= G153), G56 (= G155), K65 (= K164), N82 (= N182), D84 (= D184), E85 (= E185), G173 (= G273), E175 (= E275), N210 (= N310), G390 (≠ A490), L391 (≠ M491)
- binding nicotinamide-adenine-dinucleotide: G56 (= G155), G57 (= G156), A58 (= A157), F60 (= F159), K65 (= K164), F68 (≠ T167), E85 (= E185), E175 (= E275), R192 (≠ K292), F195 (≠ L295), I312 (≠ G412), M313 (≠ I413), S315 (≠ H415)
- binding iron/sulfur cluster: S342 (= S442), C343 (= C443), G344 (= G444), C346 (= C446), C349 (= C449), S387 (= S487), C389 (= C489), L391 (≠ M491), G392 (= G492)
Sites not aligning to the query:
7t2rB Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn-free apo state (see paper)
44% identity, 80% coverage: 103:512/512 of query aligns to 3:412/425 of 7t2rB
Sites not aligning to the query:
8a5eB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from acetobacterium woodii in the reduced state (see paper)
47% identity, 72% coverage: 142:512/512 of query aligns to 3:374/447 of 8a5eB
- binding flavin mononucleotide: G14 (= G153), G16 (= G155), N44 (= N182), G135 (= G273), E137 (= E275), N171 (= N309), N172 (= N310), G352 (≠ A490)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (= G155), G17 (= G156), F20 (= F159), K25 (= K164), F28 (≠ T167), D49 (= D187), R154 (≠ K292), F157 (≠ L295), S250 (≠ L388)
- binding iron/sulfur cluster: P151 (≠ V289), C305 (= C443), G306 (= G444), K307 (= K445), C308 (= C446), C311 (= C449), C351 (= C489), G354 (= G492)
- binding zinc ion: C288 (≠ D426)
Sites not aligning to the query:
- binding iron/sulfur cluster: 392, 399, 401, 402, 403, 405, 409, 410, 414, 429, 431, 432, 433, 435, 439, 440, 444
- binding zinc ion: 375, 381, 386
6saqB Wild-type nuoef from aquifex aeolicus bound to nadh-oh (see paper)
42% identity, 77% coverage: 118:509/512 of query aligns to 29:412/419 of 6saqB
- binding flavin mononucleotide: G64 (= G153), G66 (= G155), K75 (= K164), N91 (= N182), D93 (= D184), E94 (= E185), Y179 (= Y270), G182 (= G273), E183 (= E274), N218 (= N309), N219 (= N310), T222 (≠ S313)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{R},5~{R})-5-[[(1~{E},3~{Z})-5-azanyl-4-oxidanyl-5-oxidanylidene-penta-1,3-dienyl]-methanoyl-amino]-3,4-bis(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: G66 (= G155), G67 (= G156), A68 (= A157), F70 (= F159), K75 (= K164), E94 (= E185), E96 (≠ D187), T99 (= T190), E184 (= E275), Y204 (≠ L295), T318 (≠ H415)
- binding iron/sulfur cluster: P198 (≠ V289), T345 (≠ S442), C346 (= C443), G347 (= G444), Q348 (≠ K445), C349 (= C446), C352 (= C449), I391 (≠ L488), C392 (= C489), G395 (= G492)
7q5yC Structure of nadh:ubichinon oxidoreductase (complex i) of the hyperthermophilic eubacterium aquifex aeolicus
42% identity, 77% coverage: 118:509/512 of query aligns to 30:413/419 of 7q5yC
- binding flavin mononucleotide: G65 (= G153), G67 (= G155), K76 (= K164), N92 (= N182), E95 (= E185), Y180 (= Y270), G183 (= G273), E184 (= E274), V218 (= V308), N219 (= N309), N220 (= N310), T223 (≠ S313)
- binding iron/sulfur cluster: T346 (≠ S442), C347 (= C443), G348 (= G444), Q349 (≠ K445), C350 (= C446), C353 (= C449), S391 (= S487), I392 (≠ L488), C393 (= C489), G396 (= G492)
6q9cB Crystal structure of aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe and nuof bound to nadh under anaerobic conditions (see paper)
42% identity, 77% coverage: 118:509/512 of query aligns to 29:412/418 of 6q9cB
- binding flavin mononucleotide: G64 (= G153), G66 (= G155), K75 (= K164), N91 (= N182), D93 (= D184), E94 (= E185), G182 (= G273), E183 (= E274), E184 (= E275), V217 (= V308), N218 (= N309), N219 (= N310), T222 (≠ S313), G393 (≠ A490)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G66 (= G155), G67 (= G156), A68 (= A157), F70 (= F159), K75 (= K164), E94 (= E185), E96 (≠ D187), Y179 (= Y270), E184 (= E275), Y204 (≠ L295)
- binding iron/sulfur cluster: P198 (≠ V289), T345 (≠ S442), C346 (= C443), G347 (= G444), Q348 (≠ K445), C349 (= C446), C352 (= C449), I391 (≠ L488), C392 (= C489), L394 (≠ M491), G395 (= G492)
6hl3B Wild-type nuoef from aquifex aeolicus - oxidized form bound to NAD+ (see paper)
42% identity, 77% coverage: 118:509/512 of query aligns to 28:411/416 of 6hl3B
- binding flavin mononucleotide: G63 (= G153), G65 (= G155), K74 (= K164), N90 (= N182), D92 (= D184), E93 (= E185), G181 (= G273), E182 (= E274), E183 (= E275), V216 (= V308), N217 (= N309), N218 (= N310), T221 (≠ S313)
- binding nicotinamide-adenine-dinucleotide: G65 (= G155), G66 (= G156), A67 (= A157), F69 (= F159), K74 (= K164), E95 (≠ D187), Y178 (= Y270), E183 (= E275), K200 (= K292), Y203 (≠ L295)
- binding iron/sulfur cluster: I179 (= I271), P197 (≠ V289), T344 (≠ S442), C345 (= C443), G346 (= G444), Q347 (≠ K445), C348 (= C446), C351 (= C449), S389 (= S487), I390 (≠ L488), C391 (= C489), L393 (≠ M491), G394 (= G492)
7p61F Complex i from e. Coli, ddm-purified, with nadh, resting state (see paper)
40% identity, 79% coverage: 106:512/512 of query aligns to 13:421/442 of 7p61F
- binding flavin mononucleotide: G61 (= G153), G63 (= G155), K72 (= K164), N90 (= N182), D92 (= D184), G181 (= G273), E182 (= E274), N217 (= N309), N218 (= N310), A399 (= A490), H400 (≠ M491)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G63 (= G155), G64 (= G156), A65 (= A157), F67 (= F159), K72 (= K164), L75 (≠ T167), E95 (≠ D187), Y178 (= Y270), E183 (= E275), F203 (≠ L295), R320 (≠ G412), T323 (≠ H415)
- binding iron/sulfur cluster: S350 (= S442), C351 (= C443), W353 (≠ K445), C354 (= C446), C357 (= C449), F397 (≠ L488), C398 (= C489), H400 (≠ M491)
Q56222 NADH-quinone oxidoreductase subunit 1; NADH dehydrogenase I chain 1; NDH-1 subunit 1; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
39% identity, 80% coverage: 104:512/512 of query aligns to 14:423/438 of Q56222
4hea1 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
39% identity, 80% coverage: 104:512/512 of query aligns to 13:422/437 of 4hea1
- binding flavin mononucleotide: G63 (= G153), K74 (= K164), N91 (= N182), D93 (= D184), Y179 (= Y270), G182 (= G273), E183 (= E274), N218 (= N309), N219 (= N310), L401 (≠ M491)
- binding iron/sulfur cluster: I180 (= I271), P198 (≠ V289), S351 (= S442), C352 (= C443), G353 (= G444), K354 (= K445), C355 (= C446), C358 (= C449), F398 (≠ L488), C399 (= C489), L401 (≠ M491)
2ybb1 Fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) (see paper)
39% identity, 80% coverage: 104:512/512 of query aligns to 13:422/437 of 2ybb1
- binding flavin mononucleotide: G63 (= G153), G65 (= G155), N91 (= N182), D93 (= D184), G182 (= G273), E183 (= E274), E184 (= E275), N218 (= N309), N219 (= N310), T222 (≠ S313), P400 (≠ A490)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G65 (= G155), G66 (= G156), F69 (= F159), K74 (= K164), F77 (≠ T167), E96 (≠ D187), Y179 (= Y270), E184 (= E275), K201 (= K292), F204 (≠ L295), T324 (≠ H415)
- binding iron/sulfur cluster: S351 (= S442), C352 (= C443), K354 (= K445), C355 (= C446), C358 (= C449), F398 (≠ L488), C399 (= C489), L401 (≠ M491), A402 (≠ G492)
7b0nF 3.7-angstrom structure of Yarrowia lipolytica complex I with an R121M mutation in NUCM. (see paper)
38% identity, 79% coverage: 100:506/512 of query aligns to 6:416/460 of 7b0nF
- binding flavin mononucleotide: G60 (= G155), K69 (= K164), N90 (= N182), D92 (= D184), E93 (= E185), G94 (= G186), Y178 (= Y270), G181 (= G273), E182 (= E274), N218 (= N310)
- binding iron/sulfur cluster: P197 (≠ V289), S352 (= S442), C353 (= C443), Q355 (≠ K445), C356 (= C446), C359 (= C449), T397 (≠ S487), C399 (= C489)
7o6yB Cryo-em structure of respiratory complex i under turnover (see paper)
38% identity, 79% coverage: 100:506/512 of query aligns to 5:415/457 of 7o6yB
- binding flavin mononucleotide: G57 (= G153), G59 (= G155), K68 (= K164), N89 (= N182), D91 (= D184), E92 (= E185), G180 (= G273), E181 (= E274), E182 (= E275), T216 (≠ N309), N217 (= N310)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G59 (= G155), G60 (= G156), F63 (= F159), K68 (= K164), E94 (≠ D187), Y177 (= Y270), E182 (= E275), F202 (≠ L295), T324 (≠ H415)
- binding iron/sulfur cluster: P196 (≠ V289), S351 (= S442), C352 (= C443), G353 (= G444), Q354 (≠ K445), C355 (= C446), C358 (= C449), T396 (≠ S487), C398 (= C489), L400 (≠ M491)
Query Sequence
>GFF4233 FitnessBrowser__Marino:GFF4233
MLKRIYVPCDTTALSMGADKVAKLIERHANARGLEIELVRNGSRGLFWLEPLVEVETDSG
RIGFGPVEAHDVDALVDAGLFEGKSDHPLCLGMVEDISYLKLQQRLTFSRIGITDPLSIA
DYRSHGGFVGLEQAVSLSPQAIVDEVKASGLRGRGGAAFPTGIKWQTVHDEPWQQQKYIV
CNADEGDSGTFADRLAMECDPYMLIEGMTIAGLAVGATQGFIYLRSEYPVAHRILNEAIS
RAEAEGYLGRDVRGSGRAFNLEVRLAAGAYICGEETSLLESLEGKRGLVRAKPPLPAIKG
LFGQPTVVNNVLSFAAVPFILAKGGQTYAHYGMGKSRGTLPIQLAGNIRRGGLIELAFGV
SLREILEDFGGGTFTGRPMKAVQVGGPLMAYMPQNQWDTPMDYEAFAQLGAGIGHGGVVV
FDDTVDMGEQARFAMEFCTVESCGKCTPCRIGSVRGLEVIDRIRAGESPEANLVLLEELC
ETMVDGSLCAMGGMTPFPVQSVMKYFPDDLTA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory