SitesBLAST
Comparing GFF4233 FitnessBrowser__psRCH2:GFF4233 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9A3Q9 Omega-aminotransferase; Beta-alanine--pyruvate aminotransferase; EC 2.6.1.-; EC 2.6.1.18 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see paper)
61% identity, 95% coverage: 12:430/441 of query aligns to 10:428/439 of Q9A3Q9
- V227 (= V229) mutation to G: Decreases activity toward 3-aminobutanoate by 2-fold. Increases activity toward the aromatic beta-amino acid 3-amino-3-phenylpropanoate by 2-fold.
- R260 (= R262) mutation to L: Decreases activity toward 3-aminobutanoate by 30-fold.
- N285 (= N287) mutation to A: Decreases activity toward 3-aminobutanoate by 4-fold. Increases activity toward the aromatic beta-amino acid 3-amino-3-phenylpropanoate by 3-fold.
4uhmA Characterization of a novel transaminase from pseudomonas sp. Strain aac (see paper)
51% identity, 96% coverage: 15:438/441 of query aligns to 8:432/435 of 4uhmA
- active site: F11 (= F18), Y140 (= Y147), E213 (= E221), D246 (= D254), I249 (= I257), K275 (= K283), Q408 (≠ A414)
- binding magnesium ion: A91 (= A98), D99 (≠ N106)
- binding pyridoxal-5'-phosphate: G107 (= G114), S108 (= S115), Y140 (= Y147), H141 (= H148), G142 (= G149), E213 (= E221), D246 (= D254), V248 (= V256), I249 (= I257), K275 (= K283)
Q9I700 Beta-alanine--pyruvate aminotransferase; Beta-A--Py AT; Beta-alanine--pyruvate transaminase; Omega-amino acid aminotransferase; Omega-amino acid AT; Omega-amino acid--pyruvate aminotransferase; Omega-APT; EC 2.6.1.18 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
52% identity, 96% coverage: 15:438/441 of query aligns to 21:445/448 of Q9I700
- W61 (= W55) binding
- T327 (= T320) binding
- R414 (= R407) binding
- Q421 (≠ A414) binding
4b98A The structure of the omega aminotransferase from pseudomonas aeruginosa (see paper)
52% identity, 96% coverage: 15:438/441 of query aligns to 14:438/441 of 4b98A
- active site: F17 (= F18), Y146 (= Y147), E219 (= E221), D252 (= D254), I255 (= I257), K281 (= K283), Q414 (≠ A414)
- binding pyridoxal-5'-phosphate: G233 (= G235), Q236 (= Q238), F270 (≠ W272), G271 (= G273)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: L53 (= L54), W54 (= W55), F82 (= F83), S112 (= S113), G113 (= G114), S114 (= S115), Y146 (= Y147), H147 (= H148), G148 (= G149), E219 (= E221), S224 (= S226), D252 (= D254), V254 (= V256), I255 (= I257), K281 (= K283), Y319 (= Y319), T320 (= T320), R407 (= R407), Q414 (≠ A414)
3a8uX Crystal structure of omega-amino acid:pyruvate aminotransferase
50% identity, 97% coverage: 12:439/441 of query aligns to 10:439/441 of 3a8uX
- active site: Y145 (= Y147), D252 (= D254), K281 (= K283), Q414 (≠ A414)
- binding pyridoxal-5'-phosphate: S111 (= S113), G112 (= G114), S113 (= S115), Y145 (= Y147), H146 (= H148), G147 (= G149), E219 (= E221), D252 (= D254), V254 (= V256), I255 (= I257), K281 (= K283)
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
40% identity, 98% coverage: 2:432/441 of query aligns to 3:437/450 of 6gwiB
- active site: F18 (= F18), Y149 (= Y147), D255 (= D254), K284 (= K283)
- binding pyridoxal-5'-phosphate: S115 (= S113), G116 (= G114), S117 (= S115), Y149 (= Y147), H150 (= H148), G151 (= G149), E222 (= E221), D255 (= D254), V257 (= V256), I258 (= I257), K284 (= K283)
3i5tA Crystal structure of aminotransferase prk07036 from rhodobacter sphaeroides kd131
39% identity, 98% coverage: 8:439/441 of query aligns to 4:436/444 of 3i5tA
- active site: A14 (≠ F18), Y144 (= Y147), E216 (= E221), D249 (= D254), V252 (≠ I257), K279 (= K283), V411 (≠ A414)
- binding pyridoxal-5'-phosphate: G111 (= G114), S112 (= S115), Y144 (= Y147), H145 (= H148), E216 (= E221), D249 (= D254), V251 (= V256), K279 (= K283), Y315 (= Y319), T316 (= T320)
7qx3A Structure of the transaminase tr2e2 with eos (see paper)
38% identity, 91% coverage: 29:430/441 of query aligns to 2:407/422 of 7qx3A
7ypmA Crystal structure of transaminase cc1012 complexed with plp and l- alanine (see paper)
37% identity, 96% coverage: 16:440/441 of query aligns to 15:447/454 of 7ypmA
- binding alanine: W57 (= W55), Y150 (= Y147)
- binding pyridoxal-5'-phosphate: S116 (= S113), G117 (= G114), S118 (= S115), Y150 (= Y147), G152 (= G149), E223 (= E221), D256 (= D254), V258 (= V256), I259 (= I257), K285 (= K283)
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
38% identity, 95% coverage: 13:430/441 of query aligns to 15:436/448 of 6io1B
- active site: L20 (≠ F18), Y151 (= Y147), D257 (= D254), K286 (= K283)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G117 (≠ S113), G118 (= G114), A119 (≠ S115), N122 (≠ A118), Y151 (= Y147), H152 (= H148), D257 (= D254), V259 (= V256), I260 (= I257), K286 (= K283)
7ypnD Crystal structure of transaminase cc1012 mutant m9 complexed with plp (see paper)
37% identity, 93% coverage: 29:440/441 of query aligns to 31:447/455 of 7ypnD
- binding pyridoxal-5'-phosphate: S116 (= S113), G117 (= G114), S118 (= S115), Y150 (= Y147), H151 (= H148), G152 (= G149), E223 (= E221), D256 (= D254), V258 (= V256), K285 (= K283), F318 (≠ Y319), T319 (= T320)
5ti8B Crystal structure of an aspartate aminotransferase from pseudomonas (see paper)
38% identity, 92% coverage: 29:432/441 of query aligns to 1:371/384 of 5ti8B
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
38% identity, 97% coverage: 14:441/441 of query aligns to 10:447/447 of 5lhaA
- active site: Y146 (= Y147), D253 (= D254), K282 (= K283), T319 (= T320)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G113 (= G114), S114 (= S115), Y146 (= Y147), H147 (= H148), G148 (= G149), E220 (= E221), D253 (= D254), K282 (= K283), Y318 (= Y319), T319 (= T320)
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
38% identity, 97% coverage: 14:441/441 of query aligns to 12:449/449 of 5lh9D
- active site: Y148 (= Y147), D255 (= D254), K284 (= K283), T321 (= T320)
- binding pyridoxal-5'-phosphate: G115 (= G114), S116 (= S115), Y148 (= Y147), H149 (= H148), G150 (= G149), E222 (= E221), D255 (= D254), V257 (= V256), K284 (= K283)
6s54A Transaminase from pseudomonas fluorescens (see paper)
36% identity, 92% coverage: 28:433/441 of query aligns to 31:444/453 of 6s54A
- active site: Y152 (= Y147), D258 (= D254), K287 (= K283)
- binding pyridoxal-5'-phosphate: G119 (= G114), S120 (= S115), Y152 (= Y147), H153 (= H148), G154 (= G149), E225 (= E221), D258 (= D254), V260 (= V256), I261 (= I257), K287 (= K283)
Sites not aligning to the query:
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
36% identity, 95% coverage: 13:432/441 of query aligns to 12:436/453 of 6s4gA
- active site: F17 (= F18), Y148 (= Y147), D254 (= D254), K283 (= K283)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: S114 (= S113), G115 (= G114), S116 (= S115), Y148 (= Y147), H149 (= H148), G150 (= G149), E221 (= E221), D254 (= D254), V256 (= V256), I257 (= I257), K283 (= K283), F315 (≠ Y319), T316 (= T320)
7q9xAAA Probable aminotransferase
36% identity, 95% coverage: 13:432/441 of query aligns to 13:437/455 of 7q9xAAA
- binding (3E)-4-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}-2-oxobut-3-enoic acid: L55 (= L54), W56 (= W55), S115 (= S113), G116 (= G114), S117 (= S115), Y149 (= Y147), G151 (= G149), E222 (= E221), D255 (= D254), V257 (= V256), I258 (= I257), K284 (= K283), F316 (≠ Y319), T317 (= T320), R412 (= R407)
- binding pyridoxal-5'-phosphate: F316 (≠ Y319), T317 (= T320)
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
36% identity, 95% coverage: 13:432/441 of query aligns to 13:437/455 of 4a6tC
- active site: F18 (= F18), Y149 (= Y147), E222 (= E221), D255 (= D254), I258 (= I257), K284 (= K283), V419 (≠ A414)
- binding pyridoxal-5'-phosphate: G116 (= G114), S117 (= S115), Y149 (= Y147), H150 (= H148), G151 (= G149), E222 (= E221), D255 (= D254), V257 (= V256), I258 (= I257), K284 (= K283)
7qx0B Transaminase structure of plurienzyme (tr2e2) in complex with plp (see paper)
36% identity, 95% coverage: 13:430/441 of query aligns to 12:428/443 of 7qx0B
4ba5A Crystal structure of omega-transaminase from chromobacterium violaceum (see paper)
36% identity, 92% coverage: 29:432/441 of query aligns to 2:409/427 of 4ba5A
- active site: Y121 (= Y147), E194 (= E221), D227 (= D254), I230 (= I257), K256 (= K283), V391 (≠ A414)
- binding 3-[o-phosphonopyridoxyl]--amino-benzoic acid: L27 (= L54), W28 (= W55), G88 (= G114), S89 (= S115), Y121 (= Y147), H122 (= H148), G123 (= G149), E194 (= E221), A199 (≠ S226), D227 (= D254), V229 (= V256), R384 (= R407)
Query Sequence
>GFF4233 FitnessBrowser__psRCH2:GFF4233
MSQDFHPSASPDHFWMPFTANRQFKASPRLLESAEGMYYTASDGRQVLDGTAGLWCCNAG
HGRREISEAVSKQIAKMDFAPTFQMGHPLPFELAEKLAAISPEGLNRVFFTNSGSESADT
ALKIALAYQRAIGQGSRTRLIGRELAYHGVGFGGMSVGGMANNRRAFGPMLPGVDHLPHT
LDLQRNAFSRGLPQHGVERADELERLVTLHGAENIAAVIVEPMSGSAGVILPPVGYLQRL
REITAKHGILLIFDEVITGFGRVGEAFAAQRWGVTPDILTCAKGLTNGAIPMGAVLAADH
LFDAFMKGPESVIEFFHGYTYSGHPVACAAALATQQIYQQENLFQKAIDLEPYWQEALFS
LRDLPNVIDIRTVGLVAGIQFAAHADGVGKRGYEVFRECFEKGLLVRASGDTIALSPALI
VEKAEIDQMMALLADGIRKAG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory