SitesBLAST
Comparing GFF4234 FitnessBrowser__Marino:GFF4234 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6tg9A Cryo-em structure of nadh reduced form of NAD+-dependent formate dehydrogenase from rhodobacter capsulatus (see paper)
68% identity, 96% coverage: 17:939/966 of query aligns to 8:938/949 of 6tg9A
- active site: K289 (= K290), C380 (= C381), H381 (= H382), L545 (= L546), G582 (= G583), Q583 (= Q584)
- binding fe2/s2 (inorganic) cluster: C51 (= C61), V59 (≠ F69), G60 (= G70), C62 (= C72), C65 (= C75), C79 (= C89)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: C255 (= C256), K289 (= K290), R351 (= R352), C352 (= C353), C380 (= C381), G414 (= G415), A415 (= A416), D419 (= D420), G420 (≠ A421), H421 (= H422), P443 (= P444), R444 (= R445), P464 (= P465), N467 (= N468), L545 (= L546), G546 (= G547), H550 (= H551), G582 (= G583), Q583 (= Q584), Q583 (= Q584), G649 (= G650), E650 (= E651), S655 (= S656), N680 (= N681), S693 (= S694), K698 (= K699), D724 (= D725), T820 (= T821), T821 (= T822), R823 (= R824), R823 (= R824), I824 (= I825), L825 (= L826), N829 (= N830), V830 (= V831), Q833 (= Q834), N902 (= N903), Y918 (= Y919), K919 (= K920)
- binding iron/sulfur cluster: H111 (= H121), C115 (= C125), C118 (= C128), A120 (= A130), C124 (= C134), C176 (= C176), I177 (= I177), V178 (= V178), C179 (= C179), M180 (≠ S180), C182 (= C182), C186 (= C186), I206 (≠ V206), C218 (= C219), S220 (= S221), C221 (= C222), G222 (= G223), C224 (= C225), C228 (= C229), T230 (= T231), A231 (≠ S232), C252 (= C253), Y254 (= Y255), C255 (= C256), V257 (= V258), C259 (= C260), F261 (= F262), C287 (= C288), K289 (= K290), V423 (= V424)
7vw6A Cryo-em structure of formate dehydrogenase 1 from methylorubrum extorquens am1 (see paper)
36% identity, 93% coverage: 29:926/966 of query aligns to 2:910/913 of 7vw6A
- binding fe2/s2 (inorganic) cluster: H32 (≠ K59), C34 (= C61), H35 (≠ A62), G45 (= G70), C47 (= C72), R48 (= R73), C50 (= C75), C64 (= C89)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K263 (= K290), K339 (≠ R352), C364 (= C377), C368 (= C381), G402 (= G415), N404 (= N417), N408 (≠ A421), D431 (= D443), P432 (= P444), R433 (= R445), F447 (≠ L463), G450 (= G466), D452 (≠ N468), G525 (= G545), M526 (≠ L546), G527 (= G547), Q530 (≠ E550), H531 (= H551), G563 (= G583), Q564 (= Q584), G630 (= G650), N632 (≠ D652), S636 (= S656), Q656 (= Q676), D657 (= D677), L658 (≠ I678), T805 (= T822), R807 (= R824), R807 (= R824), V808 (≠ I825), L809 (= L826), H811 (≠ Q828), W812 (≠ Y829), H813 (≠ N830), H813 (≠ N830), T814 (≠ V831), M817 (≠ Q834), F879 (= F895), N887 (= N903), F903 (≠ Y919), K904 (= K920)
- binding iron/sulfur cluster: C145 (= C176), I146 (= I177), Q147 (≠ V178), C148 (= C179), N149 (≠ S180), C151 (= C182), C155 (= C186), N161 (≠ T192), V163 (≠ A194), I164 (≠ L195), V175 (= V206), C188 (= C219), V189 (= V220), A190 (≠ S221), C191 (= C222), G192 (= G223), C194 (= C225), C198 (= C229), P199 (= P230), T200 (= T231), A202 (≠ T233), L203 (= L234), C227 (= C253), C230 (= C256), C234 (= C260), C261 (= C288), K263 (= K290), G264 (= G291), V411 (= V424)
1fdiA Oxidized form of formate dehydrogenase h from e. Coli complexed with the inhibitor nitrite (see paper)
37% identity, 73% coverage: 249:956/966 of query aligns to 4:711/715 of 1fdiA
- active site: C11 (= C256), L41 (≠ S287), C42 (= C288), K44 (= K290), S108 (= S350), R110 (= R352), D134 (= D375), C140 (= C381), H141 (= H382), S180 (≠ A421), M297 (≠ L546), R333 (= R582), G334 (= G583), Q335 (= Q584)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K44 (= K290), R110 (= R352), G111 (≠ C353), V139 (= V380), C140 (= C381), F173 (≠ I414), G174 (= G415), Y175 (≠ A416), N176 (= N417), D179 (= D420), S180 (≠ A421), C201 (≠ I442), D202 (= D443), P203 (= P444), R204 (= R445), L218 (= L463), G221 (= G466), N223 (= N468), G296 (= G545), M297 (≠ L546), G298 (= G547), F302 (≠ H551), G334 (= G583), Q335 (= Q584), Q335 (= Q584), G402 (= G650), E403 (= E651), T408 (≠ S656), Q428 (= Q676), D429 (= D677), I430 (= I678), S445 (≠ G693), D478 (= D725), T579 (= T822), V580 (≠ G823), R581 (= R824), R581 (= R824), E582 (≠ I825), H585 (≠ Q828), Y586 (= Y829), S587 (≠ N830), C588 (≠ V831), Y654 (≠ F895), N662 (= N903), Y678 (= Y919), K679 (= K920)
- binding nitrite ion: C140 (= C381), H141 (= H382), R333 (= R582), G334 (= G583), V338 (= V587)
- binding iron/sulfur cluster: C8 (= C253), Y10 (= Y255), C11 (= C256), S13 (≠ V258), C15 (= C260), L41 (≠ S287), C42 (= C288), K44 (= K290), P182 (= P423), I183 (≠ V424)
P07658 Formate dehydrogenase H; Formate dehydrogenase-H subunit alpha; FDH-H; Formate-hydrogen-lyase-linked, selenocysteine-containing polypeptide; EC 1.17.98.4 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 73% coverage: 249:956/966 of query aligns to 4:711/715 of P07658
- C8 (= C253) binding
- Y10 (= Y255) binding
- C11 (= C256) binding
- C15 (= C260) binding
- C42 (= C288) binding
- K44 (= K290) binding
- U140 (≠ C381) modified: nonstandard, Selenocysteine
- M297 (≠ L546) binding
- Q301 (≠ E550) binding
- Q335 (= Q584) binding
- S445 (≠ G693) binding
- D478 (= D725) binding
- C588 (≠ V831) binding
- Y654 (≠ F895) binding
- Q655 (≠ H896) binding
- Y678 (= Y919) binding
- K679 (= K920) binding
2iv2X Reinterpretation of reduced form of formate dehydrogenase h from e. Coli (see paper)
37% identity, 73% coverage: 249:956/966 of query aligns to 4:693/697 of 2iv2X
- active site: C11 (= C256), L41 (≠ S287), C42 (= C288), K44 (= K290), S108 (= S350), C140 (= C381), H141 (= H382), S180 (≠ A421), M297 (≠ L546), R333 (= R582), G334 (= G583), Q335 (= Q584)
- binding guanylate-o'-phosphoric acidmono-(2-amino-5,6-dimercapto-4-oxo-3,5,6,7,8a,9,10,10a-octahydro-4h-8-oxa-1,3,9,10-tetraaza-anthracen-7-ylmethyl) ester: R110 (= R352), G111 (≠ C353), T112 (= T354), A137 (= A378), Q335 (= Q584), G402 (= G650), E403 (= E651), D404 (= D652), T408 (≠ S656), A410 (≠ P658), Q428 (= Q676), D429 (= D677), I430 (= I678), S445 (≠ G693), D478 (= D725), C588 (≠ V831), Y660 (= Y919)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: K44 (= K290), F173 (≠ I414), G174 (= G415), Y175 (≠ A416), N176 (= N417), D179 (= D420), S180 (≠ A421), D202 (= D443), P203 (= P444), R204 (= R445), N223 (= N468), G296 (= G545), M297 (≠ L546), F302 (≠ H551), G334 (= G583), R581 (= R824), E582 (≠ I825), V583 (≠ L826), H585 (≠ Q828), Y586 (= Y829), S587 (≠ N830), K661 (= K920)
- binding iron/sulfur cluster: C8 (= C253), C11 (= C256), S13 (≠ V258), C15 (= C260), L41 (≠ S287), C42 (= C288), K44 (= K290), G45 (= G291), I183 (≠ V424)
7qv7S Cryo-em structure of hydrogen-dependent co2 reductase. (see paper)
39% identity, 60% coverage: 246:823/966 of query aligns to 1:571/571 of 7qv7S
7bkbD Formate dehydrogenase - heterodisulfide reductase - formylmethanofuran dehydrogenase complex from methanospirillum hungatei (hexameric, composite structure) (see paper)
37% identity, 57% coverage: 249:799/966 of query aligns to 7:538/549 of 7bkbD
2v45A A new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand (see paper)
27% identity, 71% coverage: 244:928/966 of query aligns to 4:722/723 of 2v45A
- active site: K49 (= K290), S109 (= S350), C140 (= C381), M141 (≠ H382), A180 (= A421), M308 (≠ L546), T344 (≠ R582), G345 (= G583), Q346 (= Q584)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R14 (≠ A254), K49 (= K290), Q111 (≠ R352), C140 (= C381), G174 (= G415), N176 (= N417), E179 (≠ D420), A180 (= A421), D204 (= D443), P205 (= P444), R206 (= R445), P222 (= P465), D225 (≠ N468), C307 (≠ G545), M308 (≠ L546), G309 (= G547), Q312 (≠ E550), R313 (≠ H551), G345 (= G583), Q346 (= Q584), Q346 (= Q584), E416 (≠ G650), T417 (≠ E651), N418 (≠ D652), T422 (≠ S656), I443 (≠ Q676), E444 (≠ D677), A445 (≠ I678), F446 (= F679), P461 (≠ G693), F463 (≠ T695), S615 (≠ T822), M616 (≠ G823), R617 (= R824), R617 (= R824), V618 (≠ I825), I619 (≠ L826), H621 (≠ Q828), W622 (≠ Y829), H623 (≠ N830), H623 (≠ N830), T624 (≠ V831), T626 (≠ A833), F689 (= F895), N697 (= N903), Y713 (= Y919), K714 (= K920)
- binding iron/sulfur cluster: C13 (= C253), C16 (= C256), T18 (≠ V258), C20 (= C260), L46 (≠ S287), C47 (= C288), V183 (= V424)
2jirA A new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand (see paper)
27% identity, 71% coverage: 244:928/966 of query aligns to 1:719/720 of 2jirA
- active site: K46 (= K290), S106 (= S350), C137 (= C381), M138 (≠ H382), A177 (= A421), M305 (≠ L546), T341 (≠ R582), G342 (= G583), Q343 (= Q584)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R11 (≠ A254), K46 (= K290), Q108 (≠ R352), C137 (= C381), G171 (= G415), S172 (≠ A416), N173 (= N417), E176 (≠ D420), A177 (= A421), D201 (= D443), P202 (= P444), R203 (= R445), F217 (≠ L463), D222 (≠ N468), C304 (≠ G545), M305 (≠ L546), G306 (= G547), Q309 (≠ E550), R310 (≠ H551), G342 (= G583), Q343 (= Q584), Q343 (= Q584), E413 (≠ G650), T414 (≠ E651), N415 (≠ D652), T419 (≠ S656), I440 (≠ Q676), E441 (≠ D677), A442 (≠ I678), P458 (≠ G693), F460 (≠ T695), S612 (≠ T822), M613 (≠ G823), R614 (= R824), R614 (= R824), I616 (≠ L826), H618 (≠ Q828), W619 (≠ Y829), H620 (≠ N830), H620 (≠ N830), T621 (≠ V831), T623 (≠ A833), F686 (= F895), N694 (= N903), Y710 (= Y919), K711 (= K920)
- binding nitrite ion: V615 (≠ I825), F686 (= F895)
- binding iron/sulfur cluster: C10 (= C253), C13 (= C256), T15 (≠ V258), C17 (= C260), L43 (≠ S287), C44 (= C288), P179 (= P423), V180 (= V424)
P81186 Periplasmic nitrate reductase; EC 1.9.6.1 from Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949 / MB) (see 3 papers)
27% identity, 71% coverage: 244:928/966 of query aligns to 36:754/755 of P81186
Sites not aligning to the query:
- 1:32 signal peptide, Tat-type signal
2jiqA A new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand (see paper)
27% identity, 71% coverage: 244:928/966 of query aligns to 1:719/720 of 2jiqA
- active site: K46 (= K290), S106 (= S350), C137 (= C381), M138 (≠ H382), A177 (= A421), M305 (≠ L546), T341 (≠ R582), G342 (= G583), Q343 (= Q584)
- binding 2-amino-5,6-dimercapto-7-methyl-3,7,8a,9-tetrahydro-8-oxa-1,3,9,10-tetraaza-anthracen-4-one guanosine dinucleotide: R11 (≠ A254), Q108 (≠ R352), C137 (= C381), G171 (= G415), S172 (≠ A416), E176 (≠ D420), A177 (= A421), D201 (= D443), P202 (= P444), R203 (= R445), P219 (= P465), D222 (≠ N468), C304 (≠ G545), M305 (≠ L546), G306 (= G547), Q309 (≠ E550), R310 (≠ H551), G342 (= G583), Q343 (= Q584), Q343 (= Q584), E413 (≠ G650), T414 (≠ E651), N415 (≠ D652), T419 (≠ S656), I440 (≠ Q676), E441 (≠ D677), F443 (= F679), P458 (≠ G693), F460 (≠ T695), S612 (≠ T822), M613 (≠ G823), R614 (= R824), R614 (= R824), I616 (≠ L826), H618 (≠ Q828), W619 (≠ Y829), H620 (≠ N830), H620 (≠ N830), T621 (≠ V831), T623 (≠ A833), F686 (= F895), N694 (= N903), Y710 (= Y919), K711 (= K920)
- binding nitrate ion: M251 (≠ I490), K583 (vs. gap), V589 (≠ K799), W591 (≠ A801), R593 (≠ T803), V704 (≠ A913)
- binding iron/sulfur cluster: C10 (= C253), C13 (= C256), T15 (≠ V258), C17 (= C260), L43 (≠ S287), C44 (= C288), V180 (= V424)
7t30A Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/NAD(h) bound state (see paper)
27% identity, 73% coverage: 29:730/966 of query aligns to 4:629/666 of 7t30A
- binding fe2/s2 (inorganic) cluster: C36 (= C61), G45 (= G70), C47 (= C72), R48 (= R73), C50 (= C75), C64 (= C89)
- binding iron/sulfur cluster: F93 (≠ I118), H98 (≠ L123), F99 (≠ D124), C100 (= C125), C103 (= C128), Q105 (≠ A130), C109 (= C134), L141 (≠ F169), R147 (≠ K175), C148 (= C176), L150 (≠ V178), C151 (= C179), Q152 (≠ S180), C154 (= C182), C158 (= C186), C192 (= C219), V193 (= V220), N194 (≠ S221), C195 (= C222), G196 (= G223), A197 (= A224), C198 (= C225), C202 (= C229), P203 (= P230), T204 (= T231), G205 (≠ S232), T206 (= T233), I207 (≠ L234), C229 (= C253), C232 (= C256), G235 (= G259), C236 (= C260), L263 (≠ S287), C264 (= C288), V396 (= V424)
8oh5C Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
28% identity, 65% coverage: 164:787/966 of query aligns to 601:1136/1172 of 8oh5C
- binding iron/sulfur cluster: C613 (= C176), V614 (≠ I177), L615 (≠ V178), C616 (= C179), G617 (≠ S180), C619 (= C182), C623 (= C186), I643 (≠ V206), C656 (= C219), I657 (≠ V220), S658 (= S221), C659 (= C222), G660 (= G223), C662 (= C225), C666 (= C229), G669 (≠ S232), A670 (≠ T233), C692 (= C253), Y694 (= Y255), C695 (= C256), C699 (= C260), C725 (= C288), R727 (≠ K290), G728 (= G291), V853 (= V424)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 199, 201, 202, 203, 222, 223, 229, 230, 235, 239, 264, 265, 285, 288, 332, 471, 477, 479
- binding fe2/s2 (inorganic) cluster: 36, 45, 47, 48, 50, 64
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 330, 331, 332, 333, 353, 354, 355, 432, 433, 434, 477
- binding iron/sulfur cluster: 96, 98, 100, 102, 104, 108, 147, 149, 151, 155, 156, 164, 170, 480, 562, 563, 565, 567, 573
8e9hG Mycobacterial respiratory complex i, fully-inserted quinone (see paper)
32% identity, 46% coverage: 28:475/966 of query aligns to 4:441/782 of 8e9hG
- binding fe2/s2 (inorganic) cluster: R35 (≠ K59), C37 (= C61), D38 (≠ A62), G46 (= G70), C48 (= C72), R49 (= R73), C51 (= C75), A63 (= A87), C65 (= C89)
- binding guanosine-5'-triphosphate: R320 (= R352)
- binding iron/sulfur cluster: H99 (= H121), D102 (= D124), C103 (= C125), C106 (= C128), G109 (≠ N131), C112 (= C134), Q115 (= Q137), C152 (= C176), V153 (≠ I177), L154 (≠ V178), C155 (= C179), A156 (≠ S180), R157 (= R181), C158 (= C182), C202 (= C229), P203 (= P230), V204 (≠ T231), A206 (≠ T233), L207 (= L234), C228 (= C253), C231 (= C256), S233 (≠ V258), C235 (= C260), N262 (≠ S287), C263 (= C288), G266 (= G291), P391 (= P423), I392 (≠ V424)
Sites not aligning to the query:
- binding guanosine-5'-triphosphate: 486, 487, 554, 556, 559, 579, 580, 582, 627, 689, 695, 696, 697
8a6tA Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
43% identity, 22% coverage: 28:241/966 of query aligns to 3:211/571 of 8a6tA
- binding fe2/s2 (inorganic) cluster: C36 (= C61), D37 (≠ A62), C47 (= C72), R48 (= R73), C50 (= C75), C63 (= C89)
- binding iron/sulfur cluster: H95 (= H121), C99 (= C125), C102 (= C128), C108 (= C134), C146 (= C176), C149 (= C179), G150 (≠ S180), K151 (≠ R181), C152 (= C182), C156 (= C186), C189 (= C219), C192 (= C222), C195 (= C225), C199 (= C229), G202 (≠ S232)
Sites not aligning to the query:
- binding 2 iron/2 sulfur/5 carbonyl/2 water inorganic cluster: 229, 230, 231, 298, 323, 352, 353, 357, 412, 500
- binding iron/sulfur cluster: 299, 354, 496, 500
8a5eA Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from acetobacterium woodii in the reduced state (see paper)
41% identity, 22% coverage: 29:240/966 of query aligns to 4:212/583 of 8a5eA
- binding fe2/s2 (inorganic) cluster: T34 (≠ K59), C36 (= C61), G45 (= G70), C47 (= C72), C50 (= C75), C64 (= C89)
- binding iron/sulfur cluster: H96 (= H121), N97 (≠ P122), C100 (= C125), C103 (= C128), S106 (≠ N131), C109 (= C134), C148 (= C176), C151 (= C179), K152 (≠ S180), C154 (= C182), C158 (= C186), V166 (≠ A194), C191 (= C219), C194 (= C222), G195 (= G223), C197 (= C225), C201 (= C229), P202 (= P230), V203 (≠ T231)
Sites not aligning to the query:
4hea3 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
26% identity, 77% coverage: 28:770/966 of query aligns to 1:662/756 of 4hea3
- active site: A355 (≠ C381), A356 (≠ H382), A488 (≠ L546), P516 (≠ G583), A517 (≠ Q584)
- binding fe2/s2 (inorganic) cluster: C34 (= C61), S35 (≠ A62), G43 (= G70), C45 (= C72), R46 (= R73), C48 (= C75), C66 (= C89)
- binding iron/sulfur cluster: H98 (= H121), D101 (= D124), C102 (= C125), C105 (= C128), C111 (= C134), Q114 (= Q137), R159 (≠ K175), C160 (= C176), I161 (= I177), C163 (= C179), R165 (= R181), C166 (= C182), F181 (≠ I197), C209 (= C229), P210 (= P230), V211 (≠ T231), A213 (≠ T233), L214 (= L234), C235 (= C253), L237 (≠ Y255), C238 (= C256), V240 (= V258), G241 (= G259), C242 (= C260), C270 (= C288), G273 (= G291), I387 (≠ V424)
3i9vC Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, oxidized, 2 mol/asu (see paper)
26% identity, 77% coverage: 28:770/966 of query aligns to 1:660/754 of 3i9vC
- active site: A270 (≠ K290), A353 (≠ C381), A354 (≠ H382), A486 (≠ L546), P514 (≠ G583), A515 (≠ Q584)
- binding calcium ion: D142 (= D159), H145 (≠ D163)
- binding fe2/s2 (inorganic) cluster: C34 (= C61), S35 (≠ A62), G43 (= G70), A44 (≠ S71), C45 (= C72), R46 (= R73), C48 (= C75), C66 (= C89)
- binding manganese (ii) ion: L251 (= L271), D279 (≠ T299)
- binding iron/sulfur cluster: H98 (= H121), D101 (= D124), C102 (= C125), C105 (= C128), K107 (≠ A130), C111 (= C134), L113 (= L136), Q114 (= Q137), C158 (= C176), I159 (= I177), C161 (= C179), C164 (= C182), F179 (≠ I197), I188 (≠ V206), C207 (= C229), P208 (= P230), V209 (≠ T231), A211 (≠ T233), C233 (= C253), L235 (≠ Y255), C236 (= C256), V238 (= V258), G239 (= G259), C240 (= C260), C268 (= C288), G271 (= G291), P384 (= P423)
3i9v3 Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, oxidized, 2 mol/asu (see paper)
26% identity, 77% coverage: 28:770/966 of query aligns to 1:660/754 of 3i9v3
- active site: A353 (≠ C381), A354 (≠ H382), A486 (≠ L546), P514 (≠ G583), A515 (≠ Q584)
- binding fe2/s2 (inorganic) cluster: C34 (= C61), S35 (≠ A62), G43 (= G70), C45 (= C72), R46 (= R73), C48 (= C75), C66 (= C89)
- binding manganese (ii) ion: L251 (= L271), D279 (≠ T299)
- binding iron/sulfur cluster: H98 (= H121), D101 (= D124), C102 (= C125), C105 (= C128), C111 (= C134), Q114 (= Q137), C158 (= C176), I159 (= I177), C161 (= C179), C164 (= C182), F179 (≠ I197), I188 (≠ V206), C207 (= C229), P208 (= P230), V209 (≠ T231), A211 (≠ T233), C233 (= C253), C236 (= C256), V238 (= V258), G239 (= G259), C240 (= C260), C268 (= C288), G271 (= G291), P384 (= P423)
2ybb3 Fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) (see paper)
26% identity, 77% coverage: 28:770/966 of query aligns to 1:660/754 of 2ybb3
- active site: A353 (≠ C381), A354 (≠ H382), A486 (≠ L546), P514 (≠ G583), A515 (≠ Q584)
- binding fe2/s2 (inorganic) cluster: C34 (= C61), S35 (≠ A62), G43 (= G70), C45 (= C72), R46 (= R73), C48 (= C75), C66 (= C89)
- binding magnesium ion: L251 (= L271), D279 (≠ T299)
- binding iron/sulfur cluster: H98 (= H121), C102 (= C125), C105 (= C128), K107 (≠ A130), C111 (= C134), Q114 (= Q137), C158 (= C176), H160 (≠ V178), C161 (= C179), C164 (= C182), C207 (= C229), P208 (= P230), V209 (≠ T231), L212 (= L234), C233 (= C253), C236 (= C256), V238 (= V258), C240 (= C260), I267 (≠ S287), C268 (= C288), P384 (= P423), I385 (≠ V424)
Query Sequence
>GFF4234 FitnessBrowser__Marino:GFF4234
MLQYFDPDTSGLNPNIDYGTPPSNSETLVSLSIDGTDIAVPEGTSVLRAATLAGINIPKL
CASDNLEAFGSCRMCAVEIEGRRGYPASCTTPVSEGMTVTTQNAKLAKLRRNIMELYISD
HPLDCLTCPANGNCELQDVAGAVGLREVRYGFEGENHLDVEVDDSNPYFSFDPSKCIVCS
RCIRACEEVQGTFALTIDGRGFDSKVSAGQNDPFMDSECVSCGACVQACPTSTLMEKSVI
DAGQPEHSVVTTCAYCGVGCSFKAEMKGDQLVRMVPYKGGDANQGHSCVKGRFAFGYATH
KDRIKEPMIRESIDDPWQVVTWEEAIEFSAKKLKDTQARYGRESIGGITSSRCTNEETYL
VQKLIRAAFGNNNTDTCARVCHSPTGFGLKTTMGESAGTQTFDSVMKADTIVVIGANPTD
AHPVFASQMRKRLRQGAKLIVIDPRRIDLLKTPHGTEGIHLPLRPGTNVAMINSLAHVIV
TEGLEDKGFIESRCELKQYNQWRDFIAEERHSPEALEVVTGVSADLVRQAARAYGEAHNG
AIYYGLGVTEHSQGSTMVMGIANLAMATGNIGREGVGVNPLRGQNNVQGSCDMGSFPHEL
PGYQHVGDSAVRTKFQDAWNVVIDNEPGLRIPNMFDAAIAGSFKAMYVQGEDIAQSDPNT
QHVEAALSSLDCLIVQDIFLNETAKYAHVLLPGSTFLEKNGTFTNAERRINRVRKVMAPV
AGMEDWEVTMALSNALGYPMHYNHPSEIMDEIARLTPTFTGVSYDRLDDLGSIQWPCNDE
HPDGTPTMHTLDFPIGKGKFAVTEYVATEEKTNRKFPLLLTTGRILSQYNVGAQTRRTEN
SQWHSEDVLEIHPSDAELRGVREGDWLGVSSRVGQTVLRARISDRMLPGVVWTTFHHPGS
GANVITTDSSDWATNCPEYKVTAVQVEKVSQPSAWQRHFAQFDERQHQLLDSKAGEEERS
DVASFE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory