SitesBLAST
Comparing GFF4237 FitnessBrowser__Marino:GFF4237 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4wd1A Acetoacetyl-coa synthetase from streptomyces lividans (see paper)
43% identity, 97% coverage: 9:652/662 of query aligns to 1:632/646 of 4wd1A
P78773 Probable acetyl-coenzyme A synthetase; Acetate--CoA ligase; Acyl-activating enzyme; EC 6.2.1.1 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 94% coverage: 34:656/662 of query aligns to 26:654/662 of P78773
- T596 (≠ G598) modified: Phosphothreonine
P52910 Acetyl-coenzyme A synthetase 2; Acetate--CoA ligase 2; Acyl-activating enzyme 2; EC 6.2.1.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
28% identity, 94% coverage: 34:658/662 of query aligns to 28:675/683 of P52910
- K506 (≠ N503) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
7kdsA Crystal structure of acetyl-coa synthetase 2 in complex with adenosine-5'-propylphosphate from candida albicans
28% identity, 86% coverage: 85:656/662 of query aligns to 79:650/654 of 7kdsA
- active site: T275 (≠ S280), T427 (≠ I425), E428 (≠ A426), N534 (= N534), R539 (= R539), K620 (= K621)
- binding adenosine-5'-monophosphate-propyl ester: I321 (≠ M326), G398 (= G401), E399 (≠ S402), P400 (= P403), D422 (vs. gap), T423 (vs. gap), Y424 (vs. gap), W425 (vs. gap), Q426 (≠ S424), T427 (≠ I425), D513 (= D513), R528 (= R528), N534 (= N534), R539 (= R539)
7l4gB Crystal structure of acetyl-coa synthetase in complex with acetyl adenylate from cryptococcus neoformans h99
27% identity, 86% coverage: 86:657/662 of query aligns to 86:668/668 of 7l4gB
- active site: T280 (≠ S280), T432 (= T429), E433 (≠ D430), N539 (= N534), R544 (= R539), K631 (= K621)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] ethanoate: W325 (= W325), G403 (= G401), E404 (≠ S402), P405 (= P403), T428 (≠ I425), Y429 (≠ A426), W430 (≠ G427), M431 (≠ G428), T432 (= T429), D518 (= D513), I530 (= I525), R533 (= R528)
5u29A Crystal structure of cryptococcus neoformans h99 acetyl-coa synthetase in complex with ac-ams
27% identity, 86% coverage: 86:657/662 of query aligns to 86:668/668 of 5u29A
- active site: T280 (≠ S280), T432 (= T429), E433 (≠ D430), N539 (= N534), R544 (= R539), K631 (= K621)
- binding 5'-O-(acetylsulfamoyl)adenosine: W325 (= W325), G403 (= G401), E404 (≠ S402), P405 (= P403), T428 (≠ I425), Y429 (≠ A426), W430 (≠ G427), M431 (≠ G428), T432 (= T429), D518 (= D513), I530 (= I525), R533 (= R528)
8w0jA Acetyl-coenzyme A synthetase 2
27% identity, 86% coverage: 85:656/662 of query aligns to 80:656/662 of 8w0jA
- binding 5'-O-{(S)-hydroxy[(prop-2-yn-1-yl)oxy]phosphoryl}adenosine: G399 (= G401), E400 (≠ S402), P401 (= P403), T424 (vs. gap), Y425 (vs. gap), W426 (vs. gap), Q427 (vs. gap), T428 (≠ I425), D514 (= D513), I526 (= I525), R529 (= R528), R540 (= R539)
8v4pA Crystal structure of acetyl-coa synthetase 2 in complex with adenosine-5'-allylphosphate from candida albicans
27% identity, 86% coverage: 85:656/662 of query aligns to 79:655/660 of 8v4pA
- binding 5'-O-{(S)-hydroxy[(prop-2-en-1-yl)oxy]phosphoryl}adenosine: P152 (≠ T157), A176 (≠ P181), G177 (≠ D182), R203 (≠ Y208), T208 (≠ F213), D317 (≠ T322), E342 (≠ D345), G343 (= G346), P345 (= P348), G398 (= G401), E399 (≠ S402), P400 (= P403), T423 (vs. gap), W425 (vs. gap), Q426 (vs. gap), T427 (≠ I425), D513 (= D513), I525 (= I525), R528 (= R528), R539 (= R539)
8v4oA Crystal structure of acetyl-coa synthetase 2 in complex with amp from candida albicans
27% identity, 86% coverage: 85:656/662 of query aligns to 79:655/660 of 8v4oA
- binding adenosine monophosphate: G398 (= G401), E399 (≠ S402), P400 (= P403), T423 (vs. gap), Y424 (vs. gap), W425 (vs. gap), Q426 (vs. gap), T427 (≠ I425), D513 (= D513), I525 (= I525), R528 (= R528), R539 (= R539)
8w0dA Acetyl-coenzyme A synthetase 2
27% identity, 86% coverage: 85:656/662 of query aligns to 79:660/666 of 8w0dA
- binding 5'-O-{(R)-hydroxy[(propan-2-yl)oxy]phosphoryl}adenosine: G398 (= G401), E399 (≠ S402), P400 (= P403), T423 (vs. gap), Y424 (vs. gap), W425 (vs. gap), Q426 (≠ S424), T427 (≠ I425), D513 (= D513), I525 (= I525), R528 (= R528), R539 (= R539)
8v4rA Crystal structure of acetyl-coa synthetase 2 in complex with amp and coa from candida albicans
27% identity, 86% coverage: 85:656/662 of query aligns to 79:660/666 of 8v4rA
- binding adenosine monophosphate: G398 (= G401), E399 (≠ S402), P400 (= P403), T423 (vs. gap), Y424 (vs. gap), Q426 (≠ S424), T427 (≠ I425), D513 (= D513), I525 (= I525), R528 (= R528), R539 (= R539)
- binding coenzyme a: F175 (≠ S180), R203 (≠ Y208), R206 (≠ K211), G316 (≠ T321), H538 (≠ V538), R599 (= R596), F605 (≠ R602)
5k8fA Crystal structure of acetyl-coa synthetase in complex with atp and acetyl-amp from cryptococcus neoformans h99
27% identity, 86% coverage: 86:657/662 of query aligns to 86:656/656 of 5k8fA
- active site: T280 (≠ S280), T432 (= T429), E433 (≠ D430), N539 (= N534), R544 (= R539), K631 (= K621)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] ethanoate: W325 (= W325), I326 (≠ M326), G403 (= G401), E404 (≠ S402), P405 (= P403), T428 (≠ I425), Y429 (≠ A426), W430 (≠ G427), M431 (≠ G428), T432 (= T429), D518 (= D513), I530 (= I525), R533 (= R528), K631 (= K621)
- binding adenosine-5'-triphosphate: T280 (≠ S280), S281 (= S281), G282 (= G282), S283 (≠ T283), T284 (= T284), K288 (= K288), G403 (= G401), E404 (≠ S402), P405 (= P403), T428 (≠ I425), Y429 (≠ A426), M431 (≠ G428), T432 (= T429), D518 (= D513), I530 (= I525), R533 (= R528), K631 (= K621)
8w0cA Acetyl-coenzyme A synthetase 2
27% identity, 86% coverage: 85:656/662 of query aligns to 80:661/667 of 8w0cA
- binding 5'-O-[(S)-(cyclopentyloxy)(hydroxy)phosphoryl]adenosine: G399 (= G401), E400 (≠ S402), P401 (= P403), T424 (vs. gap), Y425 (vs. gap), W426 (vs. gap), Q427 (≠ S424), T428 (≠ I425), D514 (= D513), R529 (= R528), R540 (= R539)
8w0bA Acetyl-coenzyme A synthetase 2
27% identity, 86% coverage: 85:656/662 of query aligns to 80:661/667 of 8w0bA
- binding 5'-O-[(R)-(cyclopropyloxy)(hydroxy)phosphoryl]adenosine: V398 (≠ T400), G399 (= G401), E400 (≠ S402), P401 (= P403), T424 (vs. gap), Y425 (vs. gap), W426 (vs. gap), Q427 (≠ S424), T428 (≠ I425), D514 (= D513), I526 (= I525), R529 (= R528), R540 (= R539)
8g0vA Crystal structure of acetyl-coa synthetase in complex with a propyne ester amp inhibitor from cryptococcus neoformans h99
27% identity, 86% coverage: 86:657/662 of query aligns to 86:666/666 of 8g0vA
- binding 5'-O-{(S)-hydroxy[(prop-2-yn-1-yl)oxy]phosphoryl}adenosine: W323 (= W325), I324 (≠ M326), V400 (≠ T400), G401 (= G401), E402 (≠ S402), P403 (= P403), T426 (≠ I425), Y427 (≠ A426), W428 (≠ G427), M429 (≠ G428), T430 (= T429), D516 (= D513)
8g0uA Crystal structure of acetyl-coa synthetase in complex with an isopropyl ester amp inhibitor from cryptococcus neoformans h99
27% identity, 86% coverage: 86:657/662 of query aligns to 86:666/666 of 8g0uA
- binding 5'-O-{(R)-hydroxy[(propan-2-yl)oxy]phosphoryl}adenosine: W323 (= W325), I324 (≠ M326), G401 (= G401), E402 (≠ S402), P403 (= P403), T426 (≠ I425), Y427 (≠ A426), W428 (≠ G427), M429 (≠ G428), T430 (= T429), D516 (= D513), I528 (= I525), R531 (= R528)
7knoA Crystal structure of acetyl-coa synthetase in complex with adenosine- 5'-ethylphosphate from cryptococcus neoformans var. Grubii serotype a (h99)
27% identity, 86% coverage: 86:657/662 of query aligns to 86:666/666 of 7knoA
- active site: T280 (≠ S280), T430 (= T429), E431 (≠ D430), N537 (= N534), R542 (= R539), K629 (= K621)
- binding 5'-O-[(S)-ethoxy(hydroxy)phosphoryl]adenosine: W323 (= W325), I324 (≠ M326), G401 (= G401), E402 (≠ S402), P403 (= P403), T426 (≠ I425), Y427 (≠ A426), W428 (≠ G427), M429 (≠ G428), T430 (= T429), D516 (= D513), R531 (= R528)
8g0tA Crystal structure of acetyl-coa synthetase in complex with a cyclopropyl ester amp inhibitor from cryptococcus neoformans h99
27% identity, 86% coverage: 86:657/662 of query aligns to 85:656/656 of 8g0tA
- binding 5'-O-[(R)-(cyclopropyloxy)(hydroxy)phosphoryl]adenosine: W321 (= W325), I322 (≠ M326), G399 (= G401), E400 (≠ S402), P401 (= P403), D423 (≠ S424), T424 (≠ I425), Y425 (≠ A426), W426 (≠ G427), M427 (≠ G428), T428 (= T429), D514 (= D513), R529 (= R528), K627 (= K621)
8v5gA Crystal structure of acetyl-coa synthetase from cryptococcus neoformans h99 in complex with an ethylsulfamide amp inhibitor
28% identity, 83% coverage: 86:633/662 of query aligns to 85:640/655 of 8v5gA
- binding 5'-deoxy-5'-(ethylsulfamamido)adenosine: V401 (≠ T400), G402 (= G401), E403 (≠ S402), P404 (= P403), T427 (≠ I425), Y428 (≠ A426), W429 (≠ G427), M430 (≠ G428), D517 (= D513), I529 (= I525), K628 (= K621)
7knpA Crystal structure of acetyl-coa synthetase in complex with adenosine- 5'-butylphosphate from cryptococcus neoformans var. Grubii serotype a (h99)
28% identity, 83% coverage: 86:633/662 of query aligns to 86:641/653 of 7knpA
- active site: T280 (≠ S280), T430 (= T429), E431 (≠ D430), N537 (= N534), R542 (= R539), K629 (= K621)
- binding 5'-O-[(S)-butoxy(hydroxy)phosphoryl]adenosine: T325 (≠ M327), V400 (≠ T400), G401 (= G401), E402 (≠ S402), P403 (= P403), T426 (≠ I425), Y427 (≠ A426), W428 (≠ G427), M429 (≠ G428), T430 (= T429), D516 (= D513), I528 (= I525), R531 (= R528)
Query Sequence
>GFF4237 FitnessBrowser__Marino:GFF4237
MKNQTTPSPDILWSPSEDTLKNSRMGQFKAWLEQQGLGPFTDYHALYQWSIDELETFWQK
VWDYCGLVCDTPAEKVLGKRDMPGAEWFPGMKLNFAANLLRLADGEHADQEAVVAYCETR
PVLRRTYAQLKADAGALEAFLRDKGIQQGDRVAGVVTNGYEALVGMLAATSMGAIWSSAS
PDFGIGAILDRFGQIEPAALIVVNGYGYGGKVFARQQDFAELIAGLPTLKSVVSVQQLPD
EPPIAGNLVTTWEDMLAYGKGNAPSFTPLPPDHPVYILYSSGTTGKPKCIVHGNAGLLVN
HAKELMLHGDVGPEDRFLYFTTCGWMMWNWQASALMTGAAVITVDGSPGYPSLNFLWDTV
AEEKVTHFGTSARFIAGCRKGELKPAKTLDQSKLRVVFSTGSPLLPEDYDWVYSDGAPDA
LLGSIAGGTDICGCFVGSTPLLPVRRGEIQCRFLGVDAVAYGDDGQPVSEGRGELVCRQP
LPSMPVSFWQDPGDERYKDAYFNTFPGVWAHGDFIEFTEHGGAIIYGRSDATLNPGGVRI
GTAEIYRQVETVAEVKDSLVVGRQIDGDVEVVLLVVPAAGQEITNDLLKQLKSRIREGAS
PRHVPKRIVQVNDIPYTRSGKKVELAVARLINGSKKSDNRDALSNPEALDEIAAALTDVG
LL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory