Comparing GFF4238 FitnessBrowser__Marino:GFF4238 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P35914 Hydroxymethylglutaryl-CoA lyase, mitochondrial; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 from Homo sapiens (Human) (see 11 papers)
62% identity, 97% coverage: 3:297/303 of query aligns to 29:322/325 of P35914
Sites not aligning to the query:
3mp3B Crystal structure of human lyase in complex with inhibitor hg-coa (see paper)
62% identity, 97% coverage: 3:297/303 of query aligns to 2:295/296 of 3mp3B
2cw6A Crystal structure of human hmg-coa lyase: insights into catalysis and the molecular basis for hydroxymethylglutaric aciduria (see paper)
62% identity, 97% coverage: 3:297/303 of query aligns to 2:295/296 of 2cw6A
3mp5B Crystal structure of human lyase r41m in complex with hmg-coa (see paper)
62% identity, 97% coverage: 3:297/303 of query aligns to 2:295/296 of 3mp5B
Q8TB92 3-hydroxy-3-methylglutaryl-CoA lyase, cytoplasmic; 3-hydroxy-3-methylglutaryl-CoA lyase-like protein 1; HMGCL-like 1; Endoplasmic reticulum 3-hydroxy-3-methylglutaryl-CoA lyase; er-cHL; EC 4.1.3.4 from Homo sapiens (Human) (see 2 papers)
60% identity, 97% coverage: 3:297/303 of query aligns to 74:367/370 of Q8TB92
Sites not aligning to the query:
P13703 Hydroxymethylglutaryl-CoA lyase; HL; HMG-CoA lyase; 3-hydroxy-3-methylglutarate-CoA lyase; EC 4.1.3.4 from Pseudomonas mevalonii (see paper)
56% identity, 96% coverage: 5:296/303 of query aligns to 2:292/301 of P13703
1ydnA Crystal structure of the hmg-coa lyase from brucella melitensis, northeast structural genomics target lr35. (see paper)
56% identity, 94% coverage: 5:289/303 of query aligns to 2:283/283 of 1ydnA
6ndsA Structure of an hmg-coa lyase from acenitobacter baumannii in complex with coenzyme a and 3-methylmalate
39% identity, 97% coverage: 2:296/303 of query aligns to 3:295/305 of 6ndsA
6ktqA Crystal structure of catalytic domain of homocitrate synthase from sulfolobus acidocaldarius (sahcs(dram)) in complex with alpha- ketoglutarate/zn2+/coa (see paper)
25% identity, 77% coverage: 6:239/303 of query aligns to 21:247/399 of 6ktqA
2nx9B Crystal structure of the carboxyltransferase domain of the oxaloacetate decarboxylase na+ pump from vibrio cholerae (see paper)
32% identity, 37% coverage: 163:274/303 of query aligns to 162:266/453 of 2nx9B
Sites not aligning to the query:
3ivtB Homocitrate synthase lys4 bound to 2-og (see paper)
23% identity, 88% coverage: 9:276/303 of query aligns to 32:290/400 of 3ivtB
Q9Y823 Homocitrate synthase, mitochondrial; HCS; EC 2.3.3.14 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see 2 papers)
23% identity, 88% coverage: 9:276/303 of query aligns to 37:295/418 of Q9Y823
Sites not aligning to the query:
3ivsA Homocitrate synthase lys4 (see paper)
29% identity, 38% coverage: 162:276/303 of query aligns to 143:259/364 of 3ivsA
Sites not aligning to the query:
3mi3A Homocitrate synthase lys4 bound to lysine (see paper)
29% identity, 38% coverage: 162:276/303 of query aligns to 145:261/370 of 3mi3A
Sites not aligning to the query:
6e1jA Crystal structure of methylthioalkylmalate synthase (bjumam1.1) from brassica juncea (see paper)
23% identity, 64% coverage: 88:281/303 of query aligns to 107:298/409 of 6e1jA
Sites not aligning to the query:
4jn6C Crystal structure of the aldolase-dehydrogenase complex from mycobacterium tuberculosis hrv37 (see paper)
26% identity, 54% coverage: 108:271/303 of query aligns to 103:252/339 of 4jn6C
Sites not aligning to the query:
3rmjB Crystal structure of truncated alpha-isopropylmalate synthase from neisseria meningitidis (see paper)
26% identity, 41% coverage: 160:283/303 of query aligns to 150:274/308 of 3rmjB
Sites not aligning to the query:
P9WMK5 4-hydroxy-2-oxohexanoate aldolase; 4-hydroxy-2-keto-pentanoic acid aldolase; 4-hydroxy-2-oxopentanoate aldolase; 4-hydroxy-2-oxovalerate aldolase; HOA; EC 4.1.3.43; EC 4.1.3.39 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
26% identity, 54% coverage: 108:271/303 of query aligns to 106:255/346 of P9WMK5
Sites not aligning to the query:
Q9JZG1 2-isopropylmalate synthase; Alpha-IPM synthase; Alpha-isopropylmalate synthase; EC 2.3.3.13 from Neisseria meningitidis serogroup B (strain MC58) (see 2 papers)
26% identity, 41% coverage: 160:283/303 of query aligns to 153:277/517 of Q9JZG1
Sites not aligning to the query:
Q9FG67 Methylthioalkylmalate synthase 1, chloroplastic; 2-isopropylmalate synthase 3; EC 2.3.3.17 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
23% identity, 64% coverage: 88:281/303 of query aligns to 174:365/506 of Q9FG67
Sites not aligning to the query:
>GFF4238 FitnessBrowser__Marino:GFF4238
MAFPKQVRLVEMSPRDGLQNEPGPVIATAIKTGLIDRLADSGLSHIEAASFVSPKWVPQM
GDAAEVMAGINRKAGVRYSALTPNLKGFEGALAAKADEVAVFGAASESFTKKNINCTIAE
SLERFAPVVEEARKHGIPVRGYVSTVMGCPYEGDIAPEQVATVAKALYDMGCHEISLGDT
IGVGTPIKAKRMLEAVAAHVPMDKLAAHFHDTYGQALANLYAVLEEGVSVIDASVAGLGG
CPYAKGASGNVATEDVLYLLNGLGIKTGVDLEKLVATGDWICSQLNRQNGSKVGQATDCQ
AGS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory