SitesBLAST
Comparing GFF4240 FitnessBrowser__Marino:GFF4240 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
27% identity, 97% coverage: 2:230/235 of query aligns to 32:256/259 of 5zaiC
- active site: A65 (= A35), F70 (≠ M40), S82 (≠ L52), R86 (= R56), G110 (= G83), E113 (≠ G86), P132 (≠ S105), E133 (= E106), I138 (≠ L111), P140 (= P113), G141 (≠ A114), A226 (≠ I199), F236 (≠ R210)
- binding coenzyme a: A63 (= A33), G64 (= G34), A65 (= A35), D66 (= D36), I67 (≠ L37), P132 (≠ S105), R166 (≠ V138), F248 (= F222), K251 (= K225)
Sites not aligning to the query:
6p5uE Structure of an enoyl-coa hydratase/aldolase isolated from a lignin- degrading consortium (see paper)
31% identity, 84% coverage: 4:201/235 of query aligns to 36:233/246 of 6p5uE
- active site: M67 (≠ A35), Y72 (≠ M40), D77 (≠ E45), R89 (≠ E57), A93 (≠ L61), G117 (= G83), T120 (≠ G86), E140 (= E106), I145 (≠ L111), P147 (= P113), A148 (= A114)
- binding coenzyme a: A65 (= A33), M67 (≠ A35), D68 (= D36), L69 (= L37), W113 (≠ A79), F115 (= F81), S139 (= S105), W143 (≠ L109)
Sites not aligning to the query:
Q4WF54 Mevalonyl-coenzyme A hydratase sidH; Siderophore biosynthesis protein H; EC 4.2.1.- from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata) (see paper)
29% identity, 99% coverage: 3:234/235 of query aligns to 43:269/270 of Q4WF54
Sites not aligning to the query:
- 268:270 PTS1-type peroxisomal targeting signal
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
29% identity, 97% coverage: 2:230/235 of query aligns to 35:257/260 of 2hw5C
- active site: A68 (= A35), M73 (= M40), S83 (= S55), L87 (≠ A59), G111 (= G83), E114 (≠ G86), P133 (≠ S105), E134 (= E106), T139 (≠ L111), P141 (= P113), G142 (vs. gap), K227 (≠ I199), F237 (≠ I209)
- binding crotonyl coenzyme a: K62 (= K29), I70 (≠ L37), F109 (= F81)
Sites not aligning to the query:
6l3pA Crystal strcuture of feruloyl-coa hydratase lyase(fchl) complexed with coa
30% identity, 77% coverage: 4:184/235 of query aligns to 38:215/244 of 6l3pA
- active site: M69 (≠ A35), Y74 (≠ N46), R86 (= R56), Q90 (≠ R60), G114 (= G83), S117 (≠ G86), S136 (= S105), E137 (= E106), I142 (≠ L111), P144 (= P113), G145 (≠ A114)
- binding coenzyme a: A67 (= A33), M69 (≠ A35), D70 (= D36), L71 (= L37), G113 (= G82)
Sites not aligning to the query:
6n97A Methylmalonyl-coa decarboxylase in complex with 2-sulfonate-propionyl- amino(dethia)-coa (see paper)
27% identity, 98% coverage: 1:231/235 of query aligns to 30:258/260 of 6n97A
- active site: H65 (≠ A35), L70 (≠ M40), G109 (= G83), E112 (≠ G86), P132 (≠ E106), V137 (≠ L111), Y139 (≠ P113), E227 (≠ D200), Y237 (≠ R210)
- binding (2R)-sulfonatepropionyl-amino(dethia)-CoA: K59 (= K29), A63 (= A33), H65 (≠ A35), D66 (= D36), I67 (≠ L37), W107 (≠ F81), G108 (= G82), G109 (= G83), T131 (≠ S105), P132 (≠ E106), L135 (= L109), Y139 (≠ P113), F249 (= F222), K252 (= K225)
- binding (2S)-sulfonatepropionyl-amino(dethia)-CoA: K59 (= K29), A63 (= A33), H65 (≠ A35), D66 (= D36), I67 (≠ L37), W107 (≠ F81), G108 (= G82), G109 (= G83), T131 (≠ S105), P132 (≠ E106), L135 (= L109), Y139 (≠ P113), F249 (= F222), K252 (= K225)
Sites not aligning to the query:
6n96A Methylmalonyl-coa decarboxylase in complex with 2-sulfonate-propionyl- oxa(dethia)-coa (see paper)
27% identity, 98% coverage: 1:231/235 of query aligns to 30:258/260 of 6n96A
- active site: H65 (≠ A35), L70 (≠ M40), G109 (= G83), E112 (≠ G86), P132 (≠ E106), V137 (≠ L111), Y139 (≠ P113), E227 (≠ D200), Y237 (≠ R210)
- binding (2~{S})-1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethoxy]-1-oxidanylidene-propane-2-sulfonic acid: K59 (= K29), A63 (= A33), H65 (≠ A35), D66 (= D36), I67 (≠ L37), H68 (≠ G38), W107 (≠ F81), G108 (= G82), G109 (= G83), T131 (≠ S105), P132 (≠ E106), L135 (= L109), V137 (≠ L111), Y139 (≠ P113), F249 (= F222), K252 (= K225)
- binding (2~{R})-1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethoxy]-1-oxidanylidene-propane-2-sulfonic acid: K59 (= K29), A63 (= A33), H65 (≠ A35), D66 (= D36), I67 (≠ L37), H68 (≠ G38), W107 (≠ F81), G108 (= G82), G109 (= G83), T131 (≠ S105), P132 (≠ E106), L135 (= L109), V137 (≠ L111), Y139 (≠ P113), F249 (= F222), K252 (= K225)
6n95A Methylmalonyl-coa decarboxylase in complex with 2-sulfonate-propionyl- coa (see paper)
27% identity, 98% coverage: 1:231/235 of query aligns to 30:258/260 of 6n95A
- active site: H65 (≠ A35), L70 (≠ M40), G109 (= G83), E112 (≠ G86), P132 (≠ E106), V137 (≠ L111), Y139 (≠ P113), E227 (≠ D200), Y237 (≠ R210)
- binding (2R)-sulfonatepropionyl-CoA: K59 (= K29), A63 (= A33), H65 (≠ A35), D66 (= D36), I67 (≠ L37), H68 (≠ G38), W107 (≠ F81), G108 (= G82), G109 (= G83), T131 (≠ S105), P132 (≠ E106), L135 (= L109), Y139 (≠ P113), F249 (= F222), K252 (= K225)
- binding (2S)-sulfonatepropionyl-CoA: K59 (= K29), A63 (= A33), H65 (≠ A35), D66 (= D36), I67 (≠ L37), H68 (≠ G38), W107 (≠ F81), G108 (= G82), G109 (= G83), T131 (≠ S105), P132 (≠ E106), L135 (= L109), V137 (≠ L111), Y139 (≠ P113), F249 (= F222), K252 (= K225)
Sites not aligning to the query:
6n94A Methylmalonyl-coa decarboxylase in complex with 2-nitronate-propionyl- amino(dethia)-coa (see paper)
27% identity, 98% coverage: 1:231/235 of query aligns to 30:258/260 of 6n94A
- active site: H65 (≠ A35), L70 (≠ M40), G109 (= G83), E112 (≠ G86), P132 (≠ E106), V137 (≠ L111), Y139 (≠ P113), E227 (≠ D200), Y237 (≠ R210)
- binding [1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylamino]-1-oxidanylidene-propan-2-ylidene]-bis(oxidanidyl)azanium: A63 (= A33), H65 (≠ A35), D66 (= D36), I67 (≠ L37), H68 (≠ G38), W107 (≠ F81), G108 (= G82), G109 (= G83), T131 (≠ S105), P132 (≠ E106), Y139 (≠ P113)
Sites not aligning to the query:
6n93A Methylmalonyl-coa decarboxylase in complex with 2-nitronate-propionyl- oxa(dethia)-coa (see paper)
27% identity, 98% coverage: 1:231/235 of query aligns to 30:258/260 of 6n93A
- active site: H65 (≠ A35), L70 (≠ M40), G109 (= G83), E112 (≠ G86), P132 (≠ E106), V137 (≠ L111), Y139 (≠ P113), E227 (≠ D200), Y237 (≠ R210)
- binding [1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethoxy]-1-oxidanylidene-propan-2-ylidene]-bis(oxidanidyl)azanium: A63 (= A33), H65 (≠ A35), D66 (= D36), I67 (≠ L37), H68 (≠ G38), W107 (≠ F81), T131 (≠ S105), L135 (= L109), F249 (= F222), K252 (= K225)
Sites not aligning to the query:
6n92F Methylmalonyl-coa decarboxylase in complex with 2-nitronate-propionyl- coa (see paper)
27% identity, 98% coverage: 1:231/235 of query aligns to 30:258/260 of 6n92F
- active site: H65 (≠ A35), L70 (≠ M40), G109 (= G83), E112 (≠ G86), P132 (≠ E106), V137 (≠ L111), Y139 (≠ P113), E227 (≠ D200), Y237 (≠ R210)
- binding [1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-1-oxidanylidene-propan-2-ylidene]-bis(oxidanidyl)azanium: A63 (= A33), H65 (≠ A35), D66 (= D36), S105 (≠ A79), W107 (≠ F81), W107 (≠ F81), G108 (= G82), G109 (= G83), T127 (≠ S101), F128 (= F102), S129 (≠ C103), T131 (≠ S105), P132 (≠ E106), Y139 (≠ P113), S164 (≠ E137), P165 (≠ V138), F249 (= F222)
- binding (2E)-2-(hydroxyimino)propanoic acid: E240 (= E213)
Sites not aligning to the query:
6n92A Methylmalonyl-coa decarboxylase in complex with 2-nitronate-propionyl- coa (see paper)
27% identity, 98% coverage: 1:231/235 of query aligns to 30:258/260 of 6n92A
- active site: H65 (≠ A35), L70 (≠ M40), G109 (= G83), E112 (≠ G86), P132 (≠ E106), V137 (≠ L111), Y139 (≠ P113), E227 (≠ D200), Y237 (≠ R210)
- binding [1-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethylsulfanyl]-1-oxidanylidene-propan-2-ylidene]-bis(oxidanidyl)azanium: A63 (= A33), H65 (≠ A35), D66 (= D36), I67 (≠ L37), H68 (≠ G38), W107 (≠ F81), G108 (= G82), G109 (= G83), T131 (≠ S105), P132 (≠ E106), Y139 (≠ P113), F249 (= F222), K252 (= K225)
Sites not aligning to the query:
Q7CQ56 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
29% identity, 98% coverage: 1:230/235 of query aligns to 51:278/285 of Q7CQ56
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
28% identity, 97% coverage: 2:230/235 of query aligns to 33:255/258 of 1ey3A
- active site: A66 (= A35), M71 (= M40), S81 (≠ D54), L85 (= L58), G109 (= G83), E112 (≠ G86), P131 (≠ S105), E132 (= E106), T137 (≠ L111), P139 (= P113), G140 (vs. gap), K225 (≠ I199), F235 (≠ I209)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: A64 (= A33), G65 (= G34), A66 (= A35), D67 (= D36), I68 (≠ L37), L85 (= L58), W88 (≠ L61), G109 (= G83), P131 (≠ S105), L135 (= L109), G140 (vs. gap)
Sites not aligning to the query:
1ef9A The crystal structure of methylmalonyl coa decarboxylase complexed with 2s-carboxypropyl coa (see paper)
27% identity, 98% coverage: 1:231/235 of query aligns to 31:259/261 of 1ef9A
- active site: H66 (≠ A35), L71 (≠ M40), D82 (≠ N51), R86 (= R56), G110 (= G83), E113 (≠ G86), P133 (≠ E106), V138 (≠ L111), Y140 (≠ P113), N141 (≠ A114), E228 (≠ D200), Y238 (≠ R210)
- binding 2-carboxypropyl-coenzyme a: A64 (= A33), H66 (≠ A35), D67 (= D36), I68 (≠ L37), H69 (≠ G38), W108 (≠ F81), G110 (= G83), T132 (≠ S105), P133 (≠ E106), K253 (= K225)
P52045 Methylmalonyl-CoA decarboxylase; MMCD; Transcarboxylase; EC 4.1.1.- from Escherichia coli (strain K12) (see paper)
27% identity, 98% coverage: 1:231/235 of query aligns to 31:259/261 of P52045
- G110 (= G83) binding
- T132 (≠ S105) binding
- K253 (= K225) binding
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
28% identity, 97% coverage: 2:230/235 of query aligns to 65:287/290 of P14604
- E144 (≠ G86) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (= E106) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
28% identity, 97% coverage: 2:230/235 of query aligns to 35:257/260 of 1dubA
- active site: A68 (= A35), M73 (= M40), S83 (≠ D54), L87 (= L58), G111 (= G83), E114 (≠ G86), P133 (≠ S105), E134 (= E106), T139 (≠ L111), P141 (= P113), G142 (vs. gap), K227 (≠ I199), F237 (≠ I209)
- binding acetoacetyl-coenzyme a: A66 (= A33), A68 (= A35), D69 (= D36), I70 (≠ L37), Y107 (≠ A79), G110 (= G82), G111 (= G83), E114 (≠ G86), P133 (≠ S105), E134 (= E106), L137 (= L109), G142 (vs. gap), F233 (≠ R205), F249 (= F222)
Sites not aligning to the query:
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
28% identity, 97% coverage: 2:230/235 of query aligns to 35:255/258 of 1mj3A
- active site: A68 (= A35), M73 (= M40), S83 (≠ E50), L85 (= L52), G109 (= G83), E112 (≠ G86), P131 (≠ S105), E132 (= E106), T137 (≠ L111), P139 (= P113), G140 (vs. gap), K225 (≠ I199), F235 (≠ I209)
- binding hexanoyl-coenzyme a: A66 (= A33), G67 (= G34), A68 (= A35), D69 (= D36), I70 (≠ L37), G109 (= G83), P131 (≠ S105), E132 (= E106), L135 (= L109), G140 (vs. gap)
Sites not aligning to the query:
7xwvA Feruloyl-coa hydratase/lyase complexed with vanillin and coenzyme a (see paper)
29% identity, 93% coverage: 4:222/235 of query aligns to 35:243/244 of 7xwvA
- binding coenzyme a: A64 (= A33), G65 (= G34), M66 (≠ A35), D67 (= D36), L68 (= L37), W111 (≠ A79), F113 (= F81), G114 (= G82), G115 (= G83), S137 (= S105)
- binding 4-hydroxy-3-methoxybenzaldehyde: M66 (≠ A35), Y71 (≠ M43), F72 (≠ A44), E138 (= E106), G146 (≠ A114), G147 (≠ V115)
Sites not aligning to the query:
Query Sequence
>GFF4240 FitnessBrowser__Marino:GFF4240
MIIQQLISTLTEVNADNSVKVVILRSEGKHFSAGADLGWMRRMAENSRQENLDDSRELAR
LMNVLNHLSKPVIGLVQGAAFGGAVGLAACCDIVIATEKSSFCLSEVKLGLIPAVISPYV
VRAIGERQARRYFISAEVFTARQAQEYGLVHIVCDDVDAMEARCNEMLQQLAMNGPEAMK
AAKDLVFAVSHKPINDDVIDDTAHRIADIRVGEEGQEGLSAFLNKRKANWVPEEE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory