SitesBLAST
Comparing GFF4244 FitnessBrowser__psRCH2:GFF4244 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1lluA The ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate (see paper)
36% identity, 99% coverage: 1:325/327 of query aligns to 6:339/341 of 1lluA
- active site: C43 (= C38), H44 (≠ R39), T45 (= T40), H48 (= H43), H66 (= H60), E67 (= E61), C97 (= C91), C100 (= C94), C103 (= C97), C111 (= C105), Q115 (= Q109), C153 (= C147), T157 (≠ I151), R336 (≠ A322)
- binding 1,2-ethanediol: H44 (≠ R39), T45 (= T40), L47 (= L42), D53 (≠ E48), W92 (= W86), C153 (= C147)
- binding nicotinamide-adenine-dinucleotide: C43 (= C38), H44 (≠ R39), T45 (= T40), H48 (= H43), C153 (= C147), T157 (≠ I151), G179 (= G171), G180 (≠ A172), L181 (≠ A173), D200 (≠ S192), I201 (≠ R193), K205 (≠ A199), A243 (= A237), V244 (vs. gap), S245 (vs. gap), A248 (vs. gap), V265 (≠ A251), L267 (≠ I253), I290 (≠ A276), V291 (≠ N277), R336 (≠ A322)
- binding zinc ion: C43 (= C38), H66 (= H60), C100 (= C94), C103 (= C97), C111 (= C105), C153 (= C147)
3s2fE Crystal structure of furx nadh:furfural
37% identity, 99% coverage: 1:325/327 of query aligns to 3:336/340 of 3s2fE
- active site: C40 (= C38), H41 (≠ R39), T42 (= T40), H45 (= H43), H63 (= H60), E64 (= E61), C94 (= C91), C97 (= C94), C100 (= C97), C108 (= C105), Q112 (= Q109), C150 (= C147), T154 (≠ I151), R333 (≠ A322)
- binding furfural: T42 (= T40), W51 (≠ L49), H63 (= H60), W89 (= W86), C150 (= C147), I287 (≠ A276)
- binding nicotinamide-adenine-dinucleotide: C40 (= C38), H41 (≠ R39), T42 (= T40), C150 (= C147), T154 (≠ I151), G174 (= G169), G176 (= G171), G177 (≠ A172), L178 (≠ A173), D197 (≠ S192), I198 (≠ R193), K202 (≠ A199), T239 (≠ P236), A240 (= A237), V241 (vs. gap), N262 (≠ A251), G263 (= G252), L264 (≠ I253), I287 (≠ A276), V288 (≠ N277), R333 (≠ A322)
- binding zinc ion: C40 (= C38), H63 (= H60), C94 (= C91), C97 (= C94), C100 (= C97), C108 (= C105), C150 (= C147)
3s2fA Crystal structure of furx nadh:furfural
37% identity, 99% coverage: 1:325/327 of query aligns to 3:336/340 of 3s2fA
- active site: C40 (= C38), H41 (≠ R39), T42 (= T40), H45 (= H43), H63 (= H60), E64 (= E61), C94 (= C91), C97 (= C94), C100 (= C97), C108 (= C105), Q112 (= Q109), C150 (= C147), T154 (≠ I151), R333 (≠ A322)
- binding phosphorylisopropane: T42 (= T40), H63 (= H60), W89 (= W86), I287 (≠ A276)
- binding zinc ion: C40 (= C38), H63 (= H60), E64 (= E61), C94 (= C91), C97 (= C94), C100 (= C97), C108 (= C105), C150 (= C147)
3s2eE Crystal structure of furx nadh complex 1
37% identity, 99% coverage: 1:325/327 of query aligns to 3:336/340 of 3s2eE
- active site: C40 (= C38), H41 (≠ R39), T42 (= T40), H45 (= H43), H63 (= H60), E64 (= E61), C94 (= C91), C97 (= C94), C100 (= C97), C108 (= C105), Q112 (= Q109), C150 (= C147), T154 (≠ I151), R333 (≠ A322)
- binding nicotinamide-adenine-dinucleotide: C40 (= C38), H41 (≠ R39), T42 (= T40), C150 (= C147), T154 (≠ I151), G176 (= G171), G177 (≠ A172), L178 (≠ A173), D197 (≠ S192), I198 (≠ R193), K202 (≠ A199), T239 (≠ P236), A240 (= A237), V241 (vs. gap), S242 (vs. gap), A245 (vs. gap), N262 (≠ A251), G263 (= G252), L264 (≠ I253), I287 (≠ A276), V288 (≠ N277)
- binding zinc ion: C40 (= C38), H63 (= H60), C94 (= C91), C97 (= C94), C100 (= C97), C108 (= C105), C150 (= C147)
3s2eA Crystal structure of furx nadh complex 1
37% identity, 99% coverage: 1:325/327 of query aligns to 3:336/340 of 3s2eA
- active site: C40 (= C38), H41 (≠ R39), T42 (= T40), H45 (= H43), H63 (= H60), E64 (= E61), C94 (= C91), C97 (= C94), C100 (= C97), C108 (= C105), Q112 (= Q109), C150 (= C147), T154 (≠ I151), R333 (≠ A322)
- binding zinc ion: C40 (= C38), H63 (= H60), E64 (= E61), C94 (= C91), C97 (= C94), C100 (= C97), C108 (= C105), C150 (= C147)
4z6kA Alcohol dehydrogenase from the antarctic psychrophile moraxella sp. Tae 123
35% identity, 99% coverage: 1:325/327 of query aligns to 1:334/345 of 4z6kA
- active site: C38 (= C38), H39 (≠ R39), T40 (= T40), H43 (= H43), H61 (= H60), E62 (= E61), C92 (= C91), C95 (= C94), C98 (= C97), C106 (= C105), Q110 (= Q109), C148 (= C147), T152 (≠ I151), R331 (≠ A322)
- binding zinc ion: C38 (= C38), H61 (= H60), C92 (= C91), C95 (= C94), C98 (= C97), C106 (= C105), C148 (= C147)
Q8GIX7 Alcohol dehydrogenase; ADH; EC 1.1.1.1 from Moraxella sp. (strain TAE123) (see paper)
35% identity, 99% coverage: 1:325/327 of query aligns to 1:334/338 of Q8GIX7
- C38 (= C38) binding
- H61 (= H60) binding
- E62 (= E61) binding
- C92 (= C91) binding
- C95 (= C94) binding
- C98 (= C97) binding
- C106 (= C105) binding
- C148 (= C147) binding
P12311 Alcohol dehydrogenase; ADH-T; EC 1.1.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
33% identity, 99% coverage: 1:325/327 of query aligns to 1:334/337 of P12311
- C38 (= C38) mutation to S: No activity.
- T40 (= T40) mutation to A: No activity.; mutation to S: Little decrease in activity.
- H43 (= H43) mutation to A: No activity.; mutation to R: Higher level of activity at pH 9.
1rjwA Crystal structure of NAD(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r (see paper)
34% identity, 99% coverage: 1:325/327 of query aligns to 1:334/339 of 1rjwA
- active site: C38 (= C38), H39 (≠ R39), T40 (= T40), H43 (= H43), H61 (= H60), E62 (= E61), C92 (= C91), C95 (= C94), C98 (= C97), C106 (= C105), K110 (≠ Q109), C148 (= C147), T152 (≠ I151), R331 (≠ A322)
- binding trifluoroethanol: T40 (= T40), C148 (= C147), I285 (≠ A276)
- binding zinc ion: C38 (= C38), H61 (= H60), C92 (= C91), C95 (= C94), C98 (= C97), C106 (= C105)
3piiA Crystal structure of mutant of ht- alcohol dehydrogenase with substrate analogue butyramide
34% identity, 99% coverage: 1:325/327 of query aligns to 1:334/337 of 3piiA
- active site: C38 (= C38), H39 (≠ R39), T40 (= T40), H43 (= H43), H61 (= H60), E62 (= E61), C92 (= C91), C95 (= C94), C98 (= C97), C106 (= C105), K110 (≠ Q109), C148 (= C147), T152 (≠ I151), R331 (≠ A322)
- binding butyramide: T40 (= T40), H61 (= H60), W87 (= W86), C148 (= C147)
- binding zinc ion: C38 (= C38), H61 (= H60), E62 (= E61), C92 (= C91), C95 (= C94), C98 (= C97), C106 (= C105), C148 (= C147)
6iqdA Crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus (see paper)
33% identity, 99% coverage: 1:325/327 of query aligns to 1:334/336 of 6iqdA
- active site: C38 (= C38), T40 (= T40), H43 (= H43), H61 (= H60), C148 (= C147)
- binding zinc ion: C38 (= C38), H61 (= H60), E62 (= E61), C92 (= C91), C95 (= C94), C98 (= C97), C106 (= C105), C148 (= C147)
3meqA Crystal structure of alcohol dehydrogenase from brucella melitensis
36% identity, 99% coverage: 1:325/327 of query aligns to 3:338/341 of 3meqA
- active site: C40 (= C38), H41 (≠ R39), T42 (= T40), H45 (= H43), H63 (= H60), E64 (= E61), C94 (= C91), C97 (= C94), C100 (= C97), C108 (= C105), L112 (≠ Q109), C150 (= C147), T154 (≠ I151), R335 (≠ A322)
- binding 1,4-dihydronicotinamide adenine dinucleotide: C40 (= C38), H41 (≠ R39), T42 (= T40), H45 (= H43), C150 (= C147), T154 (≠ I151), G176 (= G171), G177 (≠ A172), L178 (≠ A173), D197 (≠ S192), I198 (≠ R193), K202 (≠ A199), T241 (≠ P236), A242 (= A237), V243 (vs. gap), S244 (vs. gap), A247 (vs. gap), N264 (≠ A251), G265 (= G252), L266 (≠ I253), I289 (≠ A276), V290 (≠ N277)
- binding zinc ion: C40 (= C38), H63 (= H60), C94 (= C91), C97 (= C94), C100 (= C97), C108 (= C105), C150 (= C147)
6n7lC Crystal structure of an alcohol dehydrogenase from elizabethkingia anophelis nuhp1
32% identity, 99% coverage: 1:325/327 of query aligns to 8:340/344 of 6n7lC
- active site: C45 (= C38), T47 (= T40), H50 (= H43), H68 (= H60), C154 (= C147)
- binding nicotinamide-adenine-dinucleotide: C45 (= C38), H46 (≠ R39), T47 (= T40), H50 (= H43), C154 (= C147), T158 (≠ I151), G178 (= G169), G180 (= G171), G181 (≠ A172), L182 (≠ A173), D201 (≠ S192), V202 (≠ R193), K206 (≠ A199), T243 (≠ Y228), A244 (= A229), V245 (≠ P230), S246 (≠ A231), A249 (≠ L234), N266 (≠ A251), G267 (= G252), L268 (≠ I253), I291 (≠ A276), V292 (≠ N277)
- binding zinc ion: C45 (= C38), H68 (= H60), C98 (= C91), C101 (= C94), C104 (= C97), C112 (= C105), C154 (= C147)
6z42A The low resolution structure of a zinc-dependent alcohol dehydrogenase from halomonas elongata.
34% identity, 98% coverage: 1:319/327 of query aligns to 4:328/336 of 6z42A
- active site: C41 (= C38), T43 (= T40), H46 (= H43), H64 (= H60), C148 (= C147)
- binding zinc ion: C41 (= C38), H64 (= H60), E65 (= E61), C95 (= C91), C98 (= C94), C101 (= C97), C109 (= C105), C148 (= C147)
2eerB Structural study of project id st2577 from sulfolobus tokodaii strain7
30% identity, 100% coverage: 1:327/327 of query aligns to 1:347/347 of 2eerB
- active site: C38 (= C38), H39 (≠ R39), S40 (≠ T40), H43 (= H43), H68 (= H60), E69 (= E61), E98 (≠ H89), C101 (= C94), C104 (= C97), C112 (= C105), R116 (≠ Q109), C154 (= C147), T158 (≠ I151), R342 (≠ A322)
- binding nicotinamide-adenine-dinucleotide: C38 (= C38), H39 (≠ R39), S40 (≠ T40), H43 (= H43), C154 (= C147), T158 (≠ I151), G178 (= G169), G181 (≠ A172), G182 (≠ A173), L183 (vs. gap), D203 (≠ S192), V204 (≠ R193), R205 (≠ P194), L247 (≠ Y228), N248 (≠ A229), V270 (≠ A251), G271 (= G252), L272 (≠ I253), F273 (≠ H254), L295 (≠ A276), V296 (≠ N277), R342 (≠ A322)
- binding zinc ion: E98 (≠ H89), C101 (= C94), C104 (= C97), C112 (= C105)
5yatA Crystal structure of mitochondrial alcohol dehydrogenase isozyme iii from komagataella phaffii gs115 (see paper)
40% identity, 48% coverage: 2:159/327 of query aligns to 7:165/347 of 5yatA
- active site: C43 (= C38), T45 (= T40), H48 (= H43), H66 (= H60), C153 (= C147)
- binding zinc ion: C43 (= C38), H66 (= H60), E67 (= E61), C97 (= C91), C100 (= C94), C103 (= C97), C111 (= C105), C153 (= C147)
5o9dA Crystal structure of r. Ruber adh-a, mutant y294f, w295a, y54f, f43h, h39y (see paper)
34% identity, 98% coverage: 7:327/327 of query aligns to 8:345/346 of 5o9dA
- active site: C38 (= C38), Y39 (≠ R39), S40 (≠ T40), H43 (= H43), H62 (= H60), E63 (= E61), C92 (= C91), C95 (= C94), C98 (= C97), C106 (= C105), A110 (≠ Q109), D153 (≠ C147), T157 (≠ I151), R340 (≠ A322)
- binding (2~{S})-2-methylpentanedioic acid: S40 (≠ T40), H62 (= H60), D153 (≠ C147), F294 (≠ A276)
- binding nicotinamide-adenine-dinucleotide: C38 (= C38), Y39 (≠ R39), S40 (≠ T40), H43 (= H43), D153 (≠ C147), T157 (≠ I151), V180 (≠ F170), G181 (= G171), G182 (≠ A172), L183 (≠ A173), D203 (≠ S192), L204 (≠ R193), R208 (≠ V197), S223 (= S214), F246 (≠ Y228), V247 (≠ A229), T252 (≠ L234), V269 (≠ A251), G270 (= G252), I271 (= I253), F294 (≠ A276), R340 (≠ A322)
- binding zinc ion: C38 (= C38), H62 (= H60), C92 (= C91), C95 (= C94), C98 (= C97), C106 (= C105), D153 (≠ C147)
6ffxA Crystal structure of r. Ruber adh-a, mutant f43h (see paper)
34% identity, 98% coverage: 7:327/327 of query aligns to 8:345/346 of 6ffxA
- active site: C38 (= C38), S40 (≠ T40), H43 (= H43), H62 (= H60), D153 (≠ C147)
- binding nicotinamide-adenine-dinucleotide: C38 (= C38), H39 (≠ R39), S40 (≠ T40), H43 (= H43), D153 (≠ C147), T157 (≠ I151), V180 (≠ F170), G181 (= G171), G182 (≠ A172), L183 (≠ A173), D203 (≠ S192), L204 (≠ R193), R208 (≠ V197), S223 (= S214), F246 (≠ Y228), V247 (≠ A229), V269 (≠ A251), R340 (≠ A322)
- binding zinc ion: C38 (= C38), H62 (= H60), C92 (= C91), C95 (= C94), C98 (= C97), C106 (= C105), D153 (≠ C147)
P00331 Alcohol dehydrogenase 2; Alcohol dehydrogenase II; ADHII; YADH-2; EC 1.1.1.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
38% identity, 48% coverage: 2:159/327 of query aligns to 8:166/348 of P00331
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
1r37A Alcohol dehydrogenase from sulfolobus solfataricus complexed with NAD(h) and 2-ethoxyethanol (see paper)
29% identity, 100% coverage: 1:327/327 of query aligns to 1:347/347 of 1r37A
- active site: C38 (= C38), H39 (≠ R39), S40 (≠ T40), H43 (= H43), H68 (= H60), E69 (= E61), E98 (≠ H89), C101 (= C94), C104 (= C97), C112 (= C105), R116 (≠ Q109), C154 (= C147), T158 (≠ I151), R342 (≠ A322)
- binding 2-ethoxyethanol: S40 (≠ T40), F49 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: C38 (= C38), H39 (≠ R39), S40 (≠ T40), H43 (= H43), C154 (= C147), T158 (≠ I151), G181 (≠ A173), G182 (≠ A174), L183 (≠ H175), D203 (≠ S192), V204 (≠ R193), R205 (≠ P194), L247 (≠ Y228), N248 (≠ A229), V270 (≠ A251), G271 (= G252), L272 (≠ I253), F273 (≠ H254), L295 (≠ A276), V296 (≠ N277), L334 (= L314), F337 (≠ G317), R342 (≠ A322)
- binding zinc ion: C38 (= C38), H68 (= H60), E98 (≠ H89), C101 (= C94), C104 (= C97), C112 (= C105), C154 (= C147)
Query Sequence
>GFF4244 FitnessBrowser__psRCH2:GFF4244
MRAMLLEITGEPLHLRDIPEPQPGPGELRVRVLACGVCRTDLHVVDGELPAAPLPIIPGH
EIVGRVDALGEGVSGFELGQRVGIPWLGHTCGTCSYCQHAEENLCDAPQFTGYTRPGGYA
EYVVADARFAFDLGEQGDAVALAPLLCAGLIGWRSLVKAGDGKRLGLYGFGAAAHIVMQV
ARWQGRDVYAFSRPGDVAAQDFARSLGAVWAGDSGELPPVPLDAAIIYAPAGELVPAALR
AVRKGGRVVCAGIHMSDIPSFPYDILWQERELVSVANLTRQDGLEFFPVAAQVGIHTETH
AYPLEQANQALDDLRHGRFQGAAVLVP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory