SitesBLAST
Comparing GFF427 FitnessBrowser__psRCH2:GFF427 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4e5kA Thermostable phosphite dehydrogenase in complex with NAD and sulfite (see paper)
96% identity, 98% coverage: 1:329/336 of query aligns to 1:329/329 of 4e5kA
- active site: L100 (= L100), R237 (= R237), D261 (= D261), E266 (= E266), H292 (= H292)
- binding nicotinamide-adenine-dinucleotide: K76 (= K76), G77 (= G77), L100 (= L100), T104 (= T104), G152 (= G152), G154 (= G154), A155 (= A155), I156 (= I156), H174 (= H174), E175 (= E175), A176 (= A176), A207 (= A207), L208 (= L208), P209 (= P209), P235 (= P235), C236 (= C236), R237 (= R237), D261 (= D261), H292 (= H292), G294 (= G294)
- binding sulfite ion: M53 (= M53), L75 (= L75), K76 (= K76), G77 (= G77), L100 (= L100), R237 (= R237), H292 (= H292)
4e5pA Thermostable phosphite dehydrogenase a176r variant in complex with nad (see paper)
95% identity, 99% coverage: 1:332/336 of query aligns to 1:332/332 of 4e5pA
- active site: L100 (= L100), R237 (= R237), D261 (= D261), E266 (= E266), H292 (= H292)
- binding nicotinamide-adenine-dinucleotide: K76 (= K76), L100 (= L100), T104 (= T104), G154 (= G154), A155 (= A155), I156 (= I156), A175 (≠ E175), R176 (≠ A176), L208 (= L208), P209 (= P209), T214 (= T214), P235 (= P235), C236 (= C236), R237 (= R237), H292 (= H292)
4e5mA Thermostable phosphite dehydrogenase e175a/a176r in complex with NADP (see paper)
95% identity, 98% coverage: 1:329/336 of query aligns to 1:329/329 of 4e5mA
- active site: L100 (= L100), R237 (= R237), D261 (= D261), E266 (= E266), H292 (= H292)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K76 (= K76), L100 (= L100), T104 (= T104), G154 (= G154), A155 (= A155), I156 (= I156), R176 (≠ A176), L208 (= L208), P209 (= P209), T214 (= T214), P235 (= P235), C236 (= C236), R237 (= R237), H292 (= H292), G294 (= G294)
6ih6A Phosphite dehydrogenase mutant i151r/p176r/m207a from ralstonia sp. 4506 in complex with non-natural cofactor nicotinamide cytosine dinucleotide
56% identity, 97% coverage: 1:327/336 of query aligns to 1:328/330 of 6ih6A
- binding [[(2S,3S,4R,5S)-5-(3-aminocarbonylpyridin-1-ium-1-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2S,3S,4R,5S)-5-(4-azanyl-2-oxidanylidene-pyrimidin-1-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: T104 (= T104), R151 (≠ L151), G154 (= G154), A155 (= A155), V156 (≠ I156), D175 (≠ E175), A207 (= A207), V208 (≠ L208), P209 (= P209), T214 (= T214), A235 (≠ P235), C236 (= C236), R237 (= R237)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
34% identity, 97% coverage: 1:327/336 of query aligns to 1:323/334 of 5aovA
- active site: L100 (= L100), R241 (= R237), D265 (= D261), E270 (= E266), H288 (= H292)
- binding glyoxylic acid: M52 (≠ F52), L53 (≠ M53), L53 (≠ M53), Y74 (≠ A74), A75 (≠ L75), V76 (≠ K76), G77 (= G77), R241 (= R237), H288 (= H292)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ K76), T104 (= T104), F158 (≠ M153), G159 (= G154), R160 (≠ A155), I161 (= I156), S180 (≠ A176), R181 (≠ K177), A211 (= A207), V212 (≠ L208), P213 (= P209), T218 (= T214), I239 (≠ P235), A240 (≠ C236), R241 (= R237), H288 (= H292), G290 (= G294)
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
36% identity, 97% coverage: 3:327/336 of query aligns to 2:322/332 of 6biiA
- active site: L99 (= L100), R240 (= R237), D264 (= D261), E269 (= E266), H287 (= H292)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V75 (≠ K76), T103 (= T104), G156 (= G152), F157 (≠ M153), G158 (= G154), R159 (≠ A155), I160 (= I156), A179 (= A176), R180 (≠ K177), S181 (≠ A178), K183 (≠ D180), V211 (≠ L208), P212 (= P209), E216 (≠ D213), T217 (= T214), V238 (≠ P235), A239 (≠ C236), R240 (= R237), D264 (= D261), H287 (= H292), G289 (= G294)
O58320 Glyoxylate reductase; EC 1.1.1.26 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)
33% identity, 97% coverage: 1:327/336 of query aligns to 1:323/334 of O58320
2dbqA Crystal structure of glyoxylate reductase (ph0597) from pyrococcus horikoshii ot3, complexed with NADP (i41) (see paper)
33% identity, 97% coverage: 1:327/336 of query aligns to 1:323/333 of 2dbqA
- active site: L100 (= L100), R241 (= R237), D265 (= D261), E270 (= E266), H288 (= H292)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ K76), T104 (= T104), L158 (≠ M153), G159 (= G154), R160 (≠ A155), I161 (= I156), S180 (≠ A176), R181 (≠ K177), T182 (≠ A178), A211 (= A207), V212 (≠ L208), P213 (= P209), T218 (= T214), I239 (≠ P235), A240 (≠ C236), R241 (= R237), D265 (= D261), H288 (= H292), G290 (= G294)
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
33% identity, 84% coverage: 33:314/336 of query aligns to 30:297/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (= L151), G147 (= G152), L148 (≠ M153), G149 (= G154), R150 (≠ A155), I151 (= I156), G152 (= G157), D170 (≠ H174), H201 (≠ A207), T202 (≠ L208), P203 (= P209)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
33% identity, 84% coverage: 33:314/336 of query aligns to 30:297/302 of 6rihA
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
33% identity, 84% coverage: 33:314/336 of query aligns to 30:297/301 of 6rj5A
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
33% identity, 84% coverage: 33:314/336 of query aligns to 30:297/303 of 6plgA
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
33% identity, 84% coverage: 33:314/336 of query aligns to 29:296/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (≠ L100), A100 (≠ T104), R149 (≠ A155), I150 (= I156), Y168 (= Y173), D169 (≠ H174), P170 (≠ K177), I171 (≠ A178), H200 (≠ A207), T201 (≠ L208), P202 (= P209), T207 (= T214), C228 (≠ P235), A229 (≠ C236), R230 (= R237), H277 (= H292), G279 (= G294)
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
33% identity, 84% coverage: 33:314/336 of query aligns to 31:298/305 of 6plfA
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
33% identity, 84% coverage: 33:314/336 of query aligns to 29:296/297 of 6rj3A
7dkmA Phgdh covalently linked to oridonin (see paper)
33% identity, 84% coverage: 33:314/336 of query aligns to 31:298/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ K76), A102 (≠ T104), G148 (= G152), R151 (≠ A155), I152 (= I156), Y170 (= Y173), D171 (≠ H174), P172 (≠ K177), I173 (≠ A178), H202 (≠ A207), T203 (≠ L208), P204 (= P209), T209 (= T214), C230 (≠ P235), A231 (≠ C236), R232 (= R237), H279 (= H292), G281 (= G294)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: E293 (≠ A309)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
33% identity, 84% coverage: 33:314/336 of query aligns to 27:294/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G154), I148 (= I156), Y166 (= Y173), D167 (≠ H174), P168 (≠ K177), I169 (≠ A178), I170 (≠ L179), H198 (≠ A207), T199 (≠ L208), L208 (= L217), R228 (= R237)
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
33% identity, 84% coverage: 33:314/336 of query aligns to 35:302/533 of O43175
- T78 (≠ K76) binding
- R135 (≠ Q135) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ AI 155:156) binding
- D175 (≠ H174) binding
- T207 (≠ L208) binding
- CAR 234:236 (≠ PCR 235:237) binding
- D260 (= D261) binding
- V261 (= V262) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HIGS 292:295) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
31% identity, 94% coverage: 2:318/336 of query aligns to 2:315/324 of 2gcgA
- active site: L103 (= L100), R241 (= R237), D265 (= D261), E270 (= E266), H289 (= H292)
- binding (2r)-2,3-dihydroxypropanoic acid: L55 (≠ M53), S78 (≠ L75), V79 (≠ K76), G80 (= G77), R241 (= R237), H289 (= H292)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V79 (≠ K76), T107 (= T104), G156 (= G152), G158 (= G154), I160 (= I156), G180 (≠ A176), R181 (≠ K177), R184 (≠ D180), C212 (≠ L208), S213 (≠ P209), T218 (= T214), I239 (≠ P235), R241 (= R237), D265 (= D261), H289 (= H292), G291 (= G294)
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
31% identity, 94% coverage: 2:318/336 of query aligns to 6:319/328 of Q9UBQ7
Query Sequence
>GFF427 FitnessBrowser__psRCH2:GFF427
MLPKLVITHRVHDEILQLLAPHCELMTNQTDSTLPREEILRRCRDAQAMMAFMPDRVDAD
FLQACPELRVVGCALKGFDNFDVDACTARGVWLTFVPDLLTVPTAELAIGLAVGLGRHLR
AADAFVRSGKFQGWQPQFYGTGLDNATVGILGMGAIGLAMADRLQGWGATLQYHEAKALD
TQTEQRLGLRRVACSELFASSDFILLALPLNADTQHLVNAELLALVRPGALLVNPCRGSV
VDEAAVLAALERGQLGGYAADVFEMEDWARADRPRLIDPALLAHPNTLFTPHIGSAVRAV
RLEIERCAAQNIIQALAGARPINAANRLPKAEPAAC
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory