SitesBLAST
Comparing GFF4276 FitnessBrowser__psRCH2:GFF4276 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2j6hA E. Coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo- l-norleucine (see paper)
63% identity, 100% coverage: 2:616/616 of query aligns to 1:608/608 of 2j6hA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W75), N98 (= N100), G99 (= G101), Y248 (= Y250), E481 (= E489), K485 (= K493), E488 (= E496), H504 (= H512), K603 (= K611)
- binding glucose-6-phosphate: T302 (= T304), S347 (= S349), Q348 (= Q350), S349 (= S351), T352 (= T354), V399 (= V406), S401 (= S408), E488 (= E496)
- binding 5-oxo-l-norleucine: C1 (= C2), R73 (= R74), W74 (= W75), T76 (= T77), H86 (= H87), N98 (= N100), G99 (= G101), D123 (= D125)
4amvA E.Coli glucosamine-6p synthase in complex with fructose-6p (see paper)
63% identity, 100% coverage: 2:616/616 of query aligns to 1:608/608 of 4amvA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W75), N98 (= N100), G99 (= G101), Y248 (= Y250), E481 (= E489), K485 (= K493), E488 (= E496), H504 (= H512), K603 (= K611)
- binding fructose -6-phosphate: G301 (= G303), T302 (= T304), S303 (= S305), S347 (= S349), Q348 (= Q350), S349 (= S351), T352 (= T354), S401 (= S408), K485 (= K493), E488 (= E496)
1jxaA Glucosamine 6-phosphate synthase with glucose 6-phosphate (see paper)
63% identity, 100% coverage: 2:616/616 of query aligns to 1:608/608 of 1jxaA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W75), N98 (= N100), G99 (= G101), Y248 (= Y250), E481 (= E489), K485 (= K493), E488 (= E496), H504 (= H512), K603 (= K611)
- binding glucose-6-phosphate: T302 (= T304), S303 (= S305), S347 (= S349), Q348 (= Q350), S349 (= S351), T352 (= T354), S401 (= S408), K485 (= K493), E488 (= E496)
1mosA Isomerase domain of glucosamine 6-phosphate synthase complexed with 2- amino-2-deoxyglucitol 6-phosphate (see paper)
64% identity, 61% coverage: 244:616/616 of query aligns to 1:367/367 of 1mosA
- active site: E240 (= E489), K244 (= K493), E247 (= E496), H263 (= H512), K362 (= K611)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T61 (= T304), S62 (= S305), S106 (= S349), Q107 (= Q350), S108 (= S351), T111 (= T354), K244 (= K493), E247 (= E496)
1morA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucose 6-phosphate (see paper)
64% identity, 60% coverage: 246:616/616 of query aligns to 2:366/366 of 1morA
- active site: E239 (= E489), K243 (= K493), E246 (= E496), H262 (= H512), K361 (= K611)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T304), S105 (= S349), Q106 (= Q350), S107 (= S351), T110 (= T354), V157 (= V406), A360 (= A610), K361 (= K611)
1moqA Isomerase domain of glucosamine 6-phosphate synthase complexed with glucosamine 6-phosphate (see paper)
64% identity, 60% coverage: 246:616/616 of query aligns to 2:366/366 of 1moqA
- active site: E239 (= E489), K243 (= K493), E246 (= E496), H262 (= H512), K361 (= K611)
- binding 2-amino-2-deoxy-6-O-phosphono-alpha-D-glucopyranose: T60 (= T304), S61 (= S305), S105 (= S349), Q106 (= Q350), S107 (= S351), T110 (= T354), V157 (= V406), A360 (= A610), K361 (= K611)
7dnrA Crystal structure of zn-bound sis domain of glucosamine-6-p synthase from e. Coli
63% identity, 59% coverage: 246:607/616 of query aligns to 2:357/357 of 7dnrA
6r4eA Crystal structure of human gfat-1 in complex with glucose-6-phosphate and l-glu (see paper)
38% identity, 100% coverage: 2:616/616 of query aligns to 1:663/663 of 6r4eA
- active site: L7 (≠ V8), R32 (= R27), W95 (= W75), N122 (= N100), G123 (= G101), E536 (= E489), K540 (= K493), E543 (= E496), H559 (= H512), K658 (= K611)
- binding glucose-6-phosphate: T358 (= T304), S359 (= S305), S403 (= S349), Q404 (= Q350), S405 (= S351), T408 (= T354), S456 (= S408), K540 (= K493), E543 (= E496)
- binding glutamic acid: C1 (= C2), R94 (= R74), W95 (= W75), T97 (= T77), G123 (= G101), D147 (= D125)
6svmA Crystal structure of human gfat-1 in complex with glucose-6-phosphate, l-glu, and udp-galnac (see paper)
38% identity, 100% coverage: 2:616/616 of query aligns to 1:660/660 of 6svmA
- active site: L7 (≠ V8), R32 (= R27), W95 (= W75), N122 (= N100), G123 (= G101), E533 (= E489), K537 (= K493), E540 (= E496), H556 (= H512), K655 (= K611)
- binding glucose-6-phosphate: C353 (= C302), T355 (= T304), S356 (= S305), S400 (= S349), Q401 (= Q350), S402 (= S351), T405 (= T354), S453 (= S408), K537 (= K493), E540 (= E496)
- binding glutamic acid: C1 (= C2), R94 (= R74), W95 (= W75), T97 (= T77), H107 (= H87), G123 (= G101), D147 (= D125)
- binding magnesium ion: S434 (≠ V389), R435 (= R390), T437 (≠ S392)
- binding uridine-diphosphate-n-acetylgalactosamine: Q289 (≠ A235), R322 (= R272), G334 (≠ A282), G424 (≠ A379), T426 (≠ C381), S434 (≠ V389), T437 (≠ S392), C439 (≠ L394), G440 (≠ T395), V441 (≠ L396), H442 (≠ L397)
6r4gA Crystal structure of human gfat-1 in complex with udp-glcnac (see paper)
38% identity, 99% coverage: 2:609/616 of query aligns to 1:652/652 of 6r4gA
- active site: L7 (≠ V8), R32 (= R27), W95 (= W75), N122 (= N100), G123 (= G101), E532 (= E489), K536 (= K493), E539 (= E496), H555 (= H512)
- binding glucose-6-phosphate: G353 (= G303), T354 (= T304), S355 (= S305), S399 (= S349), Q400 (= Q350), S401 (= S351), T404 (= T354), S452 (= S408), E539 (= E496)
- binding magnesium ion: S433 (≠ V389), R434 (= R390), T436 (≠ S392)
- binding uridine-diphosphate-n-acetylglucosamine: Q288 (≠ A235), R321 (= R272), G333 (≠ A282), G423 (≠ A379), T425 (≠ C381), S433 (≠ V389), T436 (≠ S392), C438 (≠ L394), G439 (≠ T395), V440 (≠ L396), H441 (≠ L397)
Q06210 Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1; D-fructose-6-phosphate amidotransferase 1; Glutamine:fructose-6-phosphate amidotransferase 1; GFAT 1; GFAT1; Hexosephosphate aminotransferase 1; EC 2.6.1.16 from Homo sapiens (Human) (see paper)
41% identity, 70% coverage: 188:616/616 of query aligns to 274:699/699 of Q06210
1xfgA Glutaminase domain of glucosamine 6-phosphate synthase complexed with l-glu hydroxamate (see paper)
63% identity, 38% coverage: 2:237/616 of query aligns to 1:235/238 of 1xfgA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W75), N98 (= N100), G99 (= G101)
- binding glutamine hydroxamate: C1 (= C2), R73 (= R74), W74 (= W75), T76 (= T77), H86 (= H87), N98 (= N100), G99 (= G101), D123 (= D125)
1xffA Glutaminase domain of glucosamine 6-phosphate synthase complexed with glutamate (see paper)
63% identity, 38% coverage: 2:237/616 of query aligns to 1:235/238 of 1xffA
- active site: C1 (= C2), R26 (= R27), G27 (= G28), W74 (= W75), N98 (= N100), G99 (= G101)
- binding glutamic acid: C1 (= C2), R73 (= R74), W74 (= W75), T76 (= T77), H86 (= H87), N98 (= N100), G99 (= G101), D123 (= D125)
2zj4A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
44% identity, 60% coverage: 247:616/616 of query aligns to 2:365/365 of 2zj4A
- active site: E238 (= E489), K242 (= K493), E245 (= E496), H261 (= H512), K360 (= K611)
- binding 2-deoxy-2-amino glucitol-6-phosphate: T60 (= T304), S61 (= S305), S105 (= S349), Q106 (= Q350), S107 (= S351), T110 (= T354), V156 (= V406), A157 (= A407), K242 (= K493), E245 (= E496)
2zj3A Isomerase domain of human glucose:fructose-6-phosphate amidotransferase (see paper)
44% identity, 60% coverage: 247:616/616 of query aligns to 2:365/365 of 2zj3A
- active site: E238 (= E489), K242 (= K493), E245 (= E496), H261 (= H512), K360 (= K611)
- binding 6-O-phosphono-alpha-D-glucopyranose: T60 (= T304), S61 (= S305), S105 (= S349), Q106 (= Q350), S107 (= S351), T110 (= T354), V156 (= V406), A359 (= A610), K360 (= K611)
P14742 Glutamine--fructose-6-phosphate aminotransferase [isomerizing]; GFAT; D-fructose-6-phosphate amidotransferase; Hexosephosphate aminotransferase; EC 2.6.1.16 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
37% identity, 73% coverage: 170:616/616 of query aligns to 274:717/717 of P14742
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 active site, For GATase activity
2v4mA The isomerase domain of human glutamine-fructose-6-phosphate transaminase 1 (gfpt1) in complex with fructose 6-phosphate
42% identity, 58% coverage: 247:604/616 of query aligns to 1:352/352 of 2v4mA
- active site: E237 (= E489), K241 (= K493), E244 (= E496), H260 (= H512)
- binding fructose -6-phosphate: T59 (= T304), S60 (= S305), S104 (= S349), Q105 (= Q350), S106 (= S351), T109 (= T354), A156 (= A407), S157 (= S408), K241 (= K493), E244 (= E496)
2pocB The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
39% identity, 58% coverage: 250:604/616 of query aligns to 2:352/352 of 2pocB
- active site: E236 (= E489), K240 (= K493), E243 (= E496), H259 (= H512)
- binding 6-O-phosphono-beta-D-glucopyranose: C55 (= C302), T57 (= T304), S58 (= S305), S102 (= S349), Q103 (= Q350), S104 (= S351), T107 (= T354), E243 (= E496)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (= R272), G36 (= G284), G126 (= G373), V128 (≠ L375), S136 (≠ V389), T139 (≠ S392), C141 (≠ L394), G142 (≠ T395), V143 (≠ L396), H144 (≠ L397)
2puvA The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
36% identity, 58% coverage: 248:604/616 of query aligns to 1:338/338 of 2puvA
- active site: E237 (= E489), K241 (= K493), E244 (= E496)
- binding 5-amino-5-deoxy-1-o-phosphono-d-mannitol: C56 (= C302), T58 (= T304), S103 (= S349), Q104 (= Q350), S105 (= S351), T108 (= T354), A155 (= A407), E244 (= E496)
- binding uridine-diphosphate-n-acetylglucosamine: R25 (= R272), G37 (= G284), G127 (= G373), V129 (≠ L375), S137 (≠ V389), T140 (≠ S392), C142 (≠ L394), G143 (≠ T395), V144 (≠ L396), H145 (≠ L397)
2putA The crystal structure of isomerase domain of glucosamine-6-phosphate synthase from candida albicans (see paper)
36% identity, 58% coverage: 250:604/616 of query aligns to 2:339/339 of 2putA
- active site: E236 (= E489), K240 (= K493), E243 (= E496)
- binding fructose -6-phosphate: C55 (= C302), T57 (= T304), S102 (= S349), Q103 (= Q350), S104 (= S351), T107 (= T354), A154 (= A407), S155 (= S408), K240 (= K493)
- binding uridine-diphosphate-n-acetylglucosamine: R24 (= R272), G36 (= G284), G126 (= G373), V128 (≠ L375), S136 (≠ V389), T139 (≠ S392), C141 (≠ L394), G142 (≠ T395), V143 (≠ L396), H144 (≠ L397)
Query Sequence
>GFF4276 FitnessBrowser__psRCH2:GFF4276
MCGIVGAVAERNITAILLEGLKRLEYRGYDSAGVAVLDDSGTLERLRRNGKVAELEQAQQ
QTPLVGRLGIAHTRWATHGAPCERNAHPHFSGDELAVVHNGIIENHEALRAQLKDMGYVF
VSDTDTEVIVHLLHHKLESLGDLTAALKAAVKELHGAYGLAVISAKQPDRLLAARSGSPL
VIGLGLGENFLASDQLALRQVTDRFMYLEEGDIAEIRRDSVQIWDVDGEPVQREAVQYHE
GAEAADKGAYRHFMLKEIHEQPKVVQRTLEGRLGDRQVLVEAFGPQAGELFAKVRNVQIV
ACGTSYHAGMVARYWLEELAGIPCQVEVASEFRYRKVVVQPDTLFVTISQSGETADTLAA
LRNAKQRSTEEGGYLASLAICNVGISSLVRESDLTLLTQAGPEIGVASTKAFTTQLVGLM
LLTLSLGHVRGTLSAASEAELVEELRRLPTRLGEALAMDTTVEKISEHFAEKHHTLFLGR
GAQYPVAMEGALKLKEISYIHAEAYPAGELKHGPLALVDADMPVVTVAPNNELLEKLKSN
LQEVRARGGELIVFADREAGFDNAEGIFVVNMPHIHDALAPILYTLPLQLLSYYVAVLRG
TDVDQPRNLAKSVTVE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory