SitesBLAST
Comparing GFF4358 FitnessBrowser__Marino:GFF4358 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1sb8A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-n-acetylgalactosamine (see paper)
75% identity, 97% coverage: 8:341/343 of query aligns to 4:337/341 of 1sb8A
- active site: S142 (= S146), S143 (= S147), S144 (= S148), Y166 (= Y170), K170 (= K174), N204 (= N208)
- binding nicotinamide-adenine-dinucleotide: G23 (= G27), G26 (= G30), F27 (= F31), I28 (= I32), D47 (= D51), N48 (= N52), F49 (= F53), T51 (= T55), G52 (= G56), D78 (= D82), I79 (= I83), Q98 (= Q102), A100 (= A104), T117 (≠ A121), A140 (= A144), A141 (= A145), Y166 (= Y170), K170 (= K174), Y193 (= Y197), N195 (= N199), V196 (= V200)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (= S107), S142 (= S146), S143 (= S147), S144 (= S148), Y166 (= Y170), N195 (= N199), A209 (= A213), V210 (= V214), W214 (= W218), Y225 (≠ F229), I226 (= I230), N227 (= N231), R234 (= R238), L271 (= L275), R299 (= R303), D302 (= D306), S306 (= S310)
1sb9A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-glucose (see paper)
75% identity, 97% coverage: 8:341/343 of query aligns to 3:336/340 of 1sb9A
- active site: S141 (= S146), S142 (= S147), S143 (= S148), Y165 (= Y170), K169 (= K174), N203 (= N208)
- binding nicotinamide-adenine-dinucleotide: G22 (= G27), G25 (= G30), F26 (= F31), I27 (= I32), D46 (= D51), N47 (= N52), F48 (= F53), T50 (= T55), G51 (= G56), D77 (= D82), I78 (= I83), Q97 (= Q102), A99 (= A104), T116 (≠ A121), A139 (= A144), A140 (= A145), Y165 (= Y170), K169 (= K174), Y192 (= Y197), N194 (= N199), V195 (= V200)
- binding uridine-5'-diphosphate-glucose: S141 (= S146), Y165 (= Y170), N194 (= N199), A208 (= A213), V209 (= V214), W213 (= W218), Y224 (≠ F229), I225 (= I230), N226 (= N231), L270 (= L275), R298 (= R303), D301 (= D306)
3ruhA Alternative analogs as viable substrates of udp-hexose 4-epimerases
69% identity, 98% coverage: 8:342/343 of query aligns to 4:333/336 of 3ruhA
- active site: S142 (= S146), S143 (= S147), S144 (= S148), Y166 (= Y170), K170 (= K174), N204 (= N208)
- binding nicotinamide-adenine-dinucleotide: G23 (= G27), G26 (= G30), F27 (= F31), I28 (= I32), D47 (= D51), N48 (= N52), S50 (≠ A54), T51 (= T55), G52 (= G56), D78 (= D82), I79 (= I83), Q98 (= Q102), A99 (= A103), A100 (= A104), T117 (≠ A121), A140 (= A144), A141 (= A145), S142 (= S146), Y166 (= Y170), K170 (= K174), Y193 (= Y197), V196 (= V200)
- binding [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl][(2R,3R,4R,5R,6R)-6-(hydroxymethyl)-4,5-bis(oxidanyl)-3-(2-oxidanylidenepropyl)oxan-2-yl] hydrogen phosphate: G102 (= G106), S103 (= S107), S142 (= S146), S143 (= S147), S144 (= S148), Y166 (= Y170), Y193 (= Y197), N195 (= N199), A209 (= A213), V210 (= V214), K213 (= K217), W214 (= W218), Y225 (≠ F229), I226 (= I230), N227 (= N231), R234 (= R238), L271 (= L275), R294 (= R303), D297 (= D306), V298 (= V307), S301 (= S310)
3rufA Alternative analogs as viable substrates of udp-hexose 4-epimerases
69% identity, 98% coverage: 8:342/343 of query aligns to 4:333/336 of 3rufA
- active site: S142 (= S146), S143 (= S147), S144 (= S148), Y166 (= Y170), K170 (= K174), N204 (= N208)
- binding nicotinamide-adenine-dinucleotide: G23 (= G27), G26 (= G30), F27 (= F31), I28 (= I32), D47 (= D51), N48 (= N52), S50 (≠ A54), T51 (= T55), G52 (= G56), D78 (= D82), I79 (= I83), Q98 (= Q102), A99 (= A103), A100 (= A104), T117 (≠ A121), A140 (= A144), Y166 (= Y170), K170 (= K174), Y193 (= Y197), V196 (= V200)
- binding uridine-5'-diphosphate: N195 (= N199), A209 (= A213), V210 (= V214), K213 (= K217), W214 (= W218), Y225 (≠ F229), I226 (= I230), N227 (= N231), R234 (= R238), L271 (= L275), R294 (= R303), D297 (= D306)
3lu1A Crystal structure analysis of wbgu: a udp-galnac 4-epimerase (see paper)
69% identity, 98% coverage: 8:342/343 of query aligns to 4:333/336 of 3lu1A
- active site: S142 (= S146), S143 (= S147), S144 (= S148), Y166 (= Y170), K170 (= K174), N204 (= N208)
- binding glycine: Q135 (≠ K139), K187 (= K191)
- binding nicotinamide-adenine-dinucleotide: G23 (= G27), G26 (= G30), F27 (= F31), I28 (= I32), D47 (= D51), N48 (= N52), S50 (≠ A54), T51 (= T55), G52 (= G56), D78 (= D82), I79 (= I83), Q98 (= Q102), A99 (= A103), A100 (= A104), A140 (= A144), A141 (= A145), S142 (= S146), Y166 (= Y170), K170 (= K174), Y193 (= Y197), N195 (= N199)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (= S107), S142 (= S146), S143 (= S147), S144 (= S148), Y166 (= Y170), N195 (= N199), V210 (= V214), W214 (= W218), Y225 (≠ F229), I226 (= I230), N227 (= N231), R234 (= R238), L271 (= L275), R294 (= R303), D297 (= D306)
Q7BJX9 UDP-N-acetylglucosamine 4-epimerase; UDP-GalNAc 4-epimerase; EC 5.1.3.7 from Plesiomonas shigelloides (Aeromonas shigelloides) (see 2 papers)
69% identity, 98% coverage: 8:342/343 of query aligns to 7:341/345 of Q7BJX9
- GVAGFI 26:31 (≠ GAAGFI 27:32) binding
- DNFSTG 50:55 (≠ DNFATG 51:56) binding
- DI 81:82 (= DI 82:83) binding
- QAA 101:103 (= QAA 102:104) binding
- T120 (≠ A121) binding
- SS 145:146 (= SS 146:147) binding
- S147 (= S148) mutation to T: No effect on epimerase activity.
- Y169 (= Y170) binding
- K173 (= K174) binding
- YFN 196:198 (= YFN 197:199) binding
- V199 (= V200) binding
- VIPK 213:216 (= VIPK 214:217) binding
- YIN 228:230 (≠ FIN 229:231) binding
- S236 (= S237) mutation to G: No effect on epimerase activity.
- R237 (= R238) binding
- R271 (= R272) mutation to G: No effect on epimerase activity.
- RSGD 302:305 (≠ RPGD 303:306) binding
- R307 (= R308) mutation to A: No effect on epimerase activity.
- H308 (= H309) mutation to A: No effect on epimerase activity.
- S309 (= S310) mutation to Y: Abolishes epimerase activity.
6dntA Udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid (see paper)
37% identity, 95% coverage: 19:343/343 of query aligns to 2:309/310 of 6dntA
- active site: S120 (= S146), S121 (= S147), A122 (≠ S148), Y144 (= Y170), K148 (= K174), A187 (= A213)
- binding (2R)-2-{[(2R,3R,4R,5S,6R)-3-(acetylamino)-2-{[(S)-{[(R)-{[(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methoxy}(hydroxy)phosphoryl]oxy}(hydroxy)phosphoryl]oxy}-5-hydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-4-yl]oxy}propanoic acid: A80 (≠ G106), S120 (= S146), S121 (= S147), Y144 (= Y170), F172 (= F198), N173 (= N199), A187 (= A213), V188 (= V214), K191 (= K217), V203 (≠ F229), I204 (= I230), Y205 (≠ N231), Q210 (≠ T236), R212 (= R238), I246 (≠ L275), R269 (= R303), D272 (= D306)
- binding nicotinamide-adenine-dinucleotide: G10 (= G27), G13 (= G30), F14 (= F31), I15 (= I32), D33 (= D51), N34 (= N52), L35 (≠ F53), S36 (≠ A54), S37 (≠ T55), G38 (= G56), D57 (= D82), L58 (≠ I83), L76 (≠ Q102), A77 (= A103), A78 (= A104), A80 (≠ G106), S118 (≠ A144), S119 (≠ A145), Y144 (= Y170), K148 (= K174), Y171 (= Y197), V174 (= V200)
- binding zinc ion: E209 (= E235), H275 (= H309)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
39% identity, 93% coverage: 24:342/343 of query aligns to 4:306/309 of 4zrnA
- active site: T117 (≠ S146), G119 (vs. gap), A120 (≠ S148), Y143 (= Y170), K147 (= K174), Y181 (≠ N208), G185 (≠ A213)
- binding nicotinamide-adenine-dinucleotide: G7 (= G27), G10 (= G30), F11 (= F31), I12 (= I32), D31 (= D51), N32 (= N52), S34 (≠ A54), S35 (≠ T55), G36 (= G56), S51 (≠ D82), I52 (= I83), L73 (≠ Q102), A74 (= A103), A75 (= A104), T92 (≠ A121), S115 (≠ A144), S116 (≠ A145), Y143 (= Y170), K147 (= K174), Y170 (= Y197), V173 (= V200)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S146), G119 (vs. gap), A120 (≠ S148), Y143 (= Y170), N172 (= N199), G185 (≠ A213), V186 (= V214), H201 (≠ F229), F203 (≠ N231), Y208 (≠ T236), R210 (= R238), V244 (≠ L275), R267 (= R303), D270 (= D306)
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
32% identity, 91% coverage: 24:335/343 of query aligns to 5:303/308 of 6wj9B
- active site: A119 (≠ S146), A120 (≠ S147), A121 (≠ S148), F144 (≠ Y170), K148 (= K174)
- binding nicotinamide-adenine-dinucleotide: G8 (= G27), G11 (= G30), F12 (= F31), I13 (= I32), D32 (= D51), D33 (≠ N52), S35 (≠ A54), T36 (= T55), G37 (= G56), D55 (= D82), A56 (≠ I83), L75 (≠ Q102), A76 (= A103), A77 (= A104), S94 (≠ A121), A117 (= A144), A119 (≠ S146), F144 (≠ Y170), K148 (= K174), F171 (≠ Y197), F172 (= F198), I174 (≠ V200)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (= V108), N173 (= N199), G187 (≠ A213), V188 (= V214), F192 (≠ W218), T203 (≠ F229), L204 (≠ I230), F205 (≠ N231), R212 (= R238), L248 (= L275), R271 (= R303), D274 (= D306)
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
32% identity, 91% coverage: 24:335/343 of query aligns to 4:302/307 of 6wjaA
- active site: A118 (≠ S146), A119 (≠ S147), A120 (≠ S148), F143 (≠ Y170), K147 (= K174)
- binding nicotinamide-adenine-dinucleotide: G7 (= G27), G10 (= G30), F11 (= F31), I12 (= I32), D31 (= D51), D32 (≠ N52), S34 (≠ A54), T35 (= T55), G36 (= G56), A55 (≠ I83), L74 (≠ Q102), A75 (= A103), A76 (= A104), S93 (≠ A121), F143 (≠ Y170), K147 (= K174), F170 (≠ Y197), F171 (= F198), I173 (≠ V200)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (= V108), A120 (≠ S148), N172 (= N199), G186 (≠ A213), V187 (= V214), F191 (≠ W218), T202 (≠ F229), F204 (≠ N231), R211 (= R238), L247 (= L275), R270 (= R303), D273 (= D306)
6zllA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-galacturonic acid and NAD (see paper)
31% identity, 90% coverage: 24:333/343 of query aligns to 4:303/321 of 6zllA
- active site: T126 (≠ S146), S127 (= S147), S128 (= S148), Y149 (= Y170), K153 (= K174)
- binding nicotinamide-adenine-dinucleotide: G7 (= G27), G10 (= G30), F11 (= F31), I12 (= I32), D32 (= D51), H33 (≠ N52), F34 (= F53), I35 (≠ A54), K43 (≠ E63), D62 (= D82), I63 (= I83), L81 (≠ Q102), A82 (= A103), A83 (= A104), I124 (≠ A144), T126 (≠ S146), Y149 (= Y170), K153 (= K174), Y176 (= Y197), V179 (= V200), R185 (≠ D206), M188 (≠ G209)
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: P85 (≠ G106), V87 (= V108), R88 (≠ P109), T126 (≠ S146), S127 (= S147), Y149 (= Y170), T178 (≠ N199), R185 (≠ D206), A189 (= A210), R192 (≠ A213), T204 (≠ F229), F206 (≠ N231), Q211 (≠ T236), R213 (= R238), I250 (≠ L275), E276 (≠ D306)
6zldA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid and NAD (see paper)
31% identity, 90% coverage: 24:333/343 of query aligns to 4:303/314 of 6zldA
- active site: T126 (≠ S146), S127 (= S147), S128 (= S148), Y149 (= Y170), K153 (= K174)
- binding nicotinamide-adenine-dinucleotide: G7 (= G27), G10 (= G30), F11 (= F31), I12 (= I32), D32 (= D51), H33 (≠ N52), F34 (= F53), I35 (≠ A54), K43 (≠ E63), D62 (= D82), I63 (= I83), L81 (≠ Q102), A82 (= A103), A83 (= A104), I124 (≠ A144), T126 (≠ S146), K153 (= K174), Y176 (= Y197), T178 (≠ N199), R185 (≠ D206), M188 (≠ G209)
- binding uridine-5'-diphosphate-glucuronic acid: P85 (≠ G106), R88 (≠ P109), T126 (≠ S146), S127 (= S147), S128 (= S148), Y149 (= Y170), F177 (= F198), T178 (≠ N199), R185 (≠ D206), M188 (≠ G209), A189 (= A210), R192 (≠ A213), T204 (≠ F229), F206 (≠ N231), Q211 (≠ T236), R213 (= R238), I250 (≠ L275), E276 (≠ D306)
6zl6A Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp and NAD (see paper)
31% identity, 90% coverage: 24:333/343 of query aligns to 4:303/314 of 6zl6A
- active site: T126 (≠ S146), S127 (= S147), S128 (= S148), Y149 (= Y170), K153 (= K174)
- binding nicotinamide-adenine-dinucleotide: G7 (= G27), G10 (= G30), F11 (= F31), I12 (= I32), D32 (= D51), H33 (≠ N52), F34 (= F53), I35 (≠ A54), K43 (≠ E63), D62 (= D82), I63 (= I83), L81 (≠ Q102), A82 (= A103), A83 (= A104), I124 (≠ A144), T126 (≠ S146), K153 (= K174), Y176 (= Y197), T178 (≠ N199), V179 (= V200), R185 (≠ D206), M188 (≠ G209)
- binding uridine-5'-diphosphate: T178 (≠ N199), A189 (= A210), R192 (≠ A213), T204 (≠ F229), F206 (≠ N231), Q211 (≠ T236), R213 (= R238), I250 (≠ L275), E276 (≠ D306)
6zljA Crystal structure of udp-glucuronic acid 4-epimerase y149f mutant from bacillus cereus in complex with udp-4-deoxy-4-fluoro-glucuronic acid and NAD (see paper)
30% identity, 90% coverage: 24:333/343 of query aligns to 4:303/314 of 6zljA
- active site: T126 (≠ S146), S127 (= S147), S128 (= S148), F149 (≠ Y170), K153 (= K174)
- binding nicotinamide-adenine-dinucleotide: G7 (= G27), G10 (= G30), F11 (= F31), I12 (= I32), D32 (= D51), H33 (≠ N52), F34 (= F53), I35 (≠ A54), K43 (≠ E63), D62 (= D82), I63 (= I83), L81 (≠ Q102), A82 (= A103), A83 (= A104), I124 (≠ A144), T126 (≠ S146), K153 (= K174), Y176 (= Y197), T178 (≠ N199), V179 (= V200), R185 (≠ D206), M188 (≠ G209)
- binding (2~{R},3~{S},4~{R},5~{R},6~{R})-6-[[[(2~{R},3~{S},4~{R},5~{R})-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3-fluoranyl-4,5-bis(oxidanyl)oxane-2-carboxylic acid: P85 (≠ G106), R88 (≠ P109), T126 (≠ S146), S127 (= S147), S128 (= S148), F149 (≠ Y170), F177 (= F198), T178 (≠ N199), R185 (≠ D206), M188 (≠ G209), A189 (= A210), R192 (≠ A213), T204 (≠ F229), F206 (≠ N231), Q211 (≠ T236), R213 (= R238), I250 (≠ L275), E276 (≠ D306)
6pnlA Structure of epimerase mth375 from the thermophilic pseudomurein- containing methanogen methanothermobacter thermautotrophicus
32% identity, 94% coverage: 21:343/343 of query aligns to 16:326/336 of 6pnlA
- active site: S133 (= S146), C135 (≠ S147), G136 (≠ S148), Y159 (= Y170), K163 (= K174)
- binding nicotinamide-adenine-dinucleotide: G22 (= G27), G25 (= G30), C26 (≠ F31), D46 (= D51), N47 (= N52), L48 (≠ F53), S49 (≠ A54), S50 (≠ T55), S51 (≠ G56), D68 (= D82), I69 (= I83), L89 (≠ Q102), A91 (= A104), F93 (≠ G106), V108 (≠ A121), S131 (≠ A144), S133 (= S146), Y159 (= Y170), K163 (= K174), F186 (≠ Y197), N188 (= N199), V189 (= V200), R200 (≠ A212)
- binding uridine-5'-diphosphate: N188 (= N199), N201 (≠ A213), V202 (= V214), F206 (≠ W218), P217 (≠ F229), I218 (= I230), T219 (≠ N231), R226 (= R238), V262 (≠ L275), R285 (= R303)
6pmhA Structure of epimerase mth375 from the thermophilic pseudomurein- containing methanogen methanothermobacter thermautotrophicus
32% identity, 94% coverage: 21:343/343 of query aligns to 10:320/330 of 6pmhA
- active site: S127 (= S146), C129 (≠ S147), G130 (≠ S148), Y153 (= Y170), K157 (= K174)
- binding adenosine monophosphate: G16 (= G27), G19 (= G30), D40 (= D51), N41 (= N52), S43 (≠ A54), S44 (≠ T55), S45 (≠ G56), D62 (= D82), I63 (= I83), A84 (= A103), F87 (≠ G106), R194 (≠ A212)
- binding uridine-5'-diphosphate: C129 (≠ S147), N182 (= N199), N195 (≠ A213), V196 (= V214), F200 (≠ W218), P211 (≠ F229), I212 (= I230), T213 (≠ N231), R220 (= R238), V256 (≠ L275), R279 (= R303)
7ys9A Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chaina from mycobacterium tuberculosis
31% identity, 92% coverage: 24:340/343 of query aligns to 4:308/310 of 7ys9A
- binding galactose-uridine-5'-diphosphate: I81 (≠ G106), R84 (≠ P109), S121 (= S146), G123 (≠ S147), Y146 (= Y170), A174 (≠ F198), N175 (= N199), A187 (= A212), G188 (≠ A213), V189 (= V214), F193 (≠ W218), R204 (≠ F229), F206 (≠ N231), N211 (≠ T236), R213 (= R238), D248 (≠ L275), R271 (= R303)
- binding nicotinamide-adenine-dinucleotide: G7 (= G27), G10 (= G30), F11 (= F31), I12 (= I32), D31 (= D51), N32 (= N52), A34 (= A54), T35 (= T55), G36 (= G56), D56 (≠ Q77), I57 (≠ S78), L77 (≠ Q102), A78 (= A103), A79 (= A104), I81 (≠ G106), T119 (≠ A144), Y146 (= Y170), K150 (= K174), P173 (≠ Y197), A174 (≠ F198), V176 (= V200)
- binding uridine-5'-diphosphate-glucose: I81 (≠ G106), R84 (≠ P109), S121 (= S146), G123 (≠ S147), Y146 (= Y170), A174 (≠ F198), N175 (= N199), A187 (= A212), G188 (≠ A213), V189 (= V214), F193 (≠ W218), R204 (≠ F229), F206 (≠ N231), N211 (≠ T236), R213 (= R238), D248 (≠ L275), R271 (= R303)
7ystA Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chain b from mycobacterium tuberculosis
31% identity, 92% coverage: 24:340/343 of query aligns to 4:308/312 of 7ystA
- binding nicotinamide-adenine-dinucleotide: G7 (= G27), G10 (= G30), F11 (= F31), I12 (= I32), D31 (= D51), N32 (= N52), T35 (= T55), G36 (= G56), D56 (≠ Q77), I57 (≠ S78), L77 (≠ Q102), A78 (= A103), A79 (= A104), I81 (≠ G106), V96 (≠ A121), T119 (≠ A144), Y146 (= Y170), K150 (= K174), P173 (≠ Y197), A174 (≠ F198), N175 (= N199), V176 (= V200)
- binding uridine-5'-diphosphate-glucose: I81 (≠ G106), R84 (≠ P109), S121 (= S146), G123 (≠ S147), Y146 (= Y170), A174 (≠ F198), N175 (= N199), A187 (= A212), G188 (≠ A213), V189 (= V214), F193 (≠ W218), R204 (≠ F229), V205 (≠ I230), F206 (≠ N231), R213 (= R238), D248 (≠ L275), R271 (= R303)
7ysmA Crystal structure of udp-glucose 4-epimerase (rv3634c) co-crystallized with udp-n-acetylglucosamine from mycobacterium tuberculosis
31% identity, 92% coverage: 24:340/343 of query aligns to 4:308/311 of 7ysmA
- binding nicotinamide-adenine-dinucleotide: G7 (= G27), G10 (= G30), F11 (= F31), I12 (= I32), D31 (= D51), N32 (= N52), T35 (= T55), G36 (= G56), D56 (≠ Q77), I57 (≠ S78), L77 (≠ Q102), A78 (= A103), A79 (= A104), I81 (≠ G106), T119 (≠ A144), Y146 (= Y170), K150 (= K174), P173 (≠ Y197), N175 (= N199), V176 (= V200)
- binding uridine-diphosphate-n-acetylgalactosamine: I81 (≠ G106), R84 (≠ P109), S121 (= S146), G123 (≠ S147), S124 (= S148), Y146 (= Y170), A174 (≠ F198), N175 (= N199), G188 (≠ A213), V189 (= V214), F193 (≠ W218), R204 (≠ F229), V205 (≠ I230), F206 (≠ N231), N211 (≠ T236), R213 (= R238), D248 (≠ L275), R271 (= R303)
5u4qA 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
29% identity, 93% coverage: 23:340/343 of query aligns to 4:315/321 of 5u4qA
- binding nicotinamide-adenine-dinucleotide: G8 (= G27), G11 (= G30), F12 (= F31), I13 (= I32), D32 (= D51), N33 (= N52), N35 (≠ A54), Y38 (≠ H57), K43 (≠ D62), D61 (= D82), L62 (≠ I83), L83 (≠ Q102), A84 (= A103), A85 (= A104), A118 (= A144), Y145 (= Y170), K149 (= K174), F172 (≠ Y197), F173 (= F198), T174 (≠ N199), V175 (= V200), R181 (≠ D206)
Query Sequence
>GFF4358 FitnessBrowser__Marino:GFF4358
MLSADNRRYPQLLDQLPSQPKTWLITGAAGFIGSNLLEHLLKLNQHVIALDNFATGHQSN
LDEVRSLVSTEQWTRLQSIEGDIRNPEDCARACEGVDYVLHQAALGSVPRSLNDPITTNA
ANITGFLNMLVAARDAGVKSFTYAASSSTYGDHPALPKVEEKIGKPLSPYAVTKHVNELY
AEVFARSYGFKAIGLRYFNVFGKRQDPNGAYAAVIPKWTAAMVRGEDVFINGDGETSRDF
CFIENAVQANLLAATAEDSARNEVYNVAVGDRTTLNDLFAALKSALAENGVVYDKAPVYR
DFRPGDVRHSQADIGKASSRLGYNPEFRIVEGIAKAMPWYLKH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory