Comparing GFF4361 FitnessBrowser__WCS417:GFF4361 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
2a9gD Structure of c406a arginine deiminase in complex with l-arginine (see paper)
81% identity, 98% coverage: 7:417/418 of query aligns to 2:406/406 of 2a9gD
1s9rA Crystal structure of arginine deiminase covalently linked with a reaction intermediate (see paper)
30% identity, 98% coverage: 10:418/418 of query aligns to 12:409/409 of 1s9rA
1lxyA Crystal structure of arginine deiminase covalently linked with l- citrulline (see paper)
30% identity, 98% coverage: 10:418/418 of query aligns to 12:409/409 of 1lxyA
>GFF4361 FitnessBrowser__WCS417:GFF4361
MTTEKVKYGVHSEAGKLRKVMVCSPGLAHQRLTPNNCDELLFDDVLWVAQAKRDHFDFVT
KMRERDIDVLEMHNLLTDIVAIPEALDWILERKITANTVGLGLVDEVSSWLRSLEPRKIS
EFLIGGVSADDLPSSFGGKTIEMFRDFLGHSSFILPPLPNTQFTRDTTCWIYGGVTLNPM
YWPARRQETLLASAIYKFHPEFTNADFQIWYGDPDQEHGASTLEGGDVMPIGNGVVLIGM
GERSSHQAIGQLARNLFKNKAVEKVIVAGLPKSRAAMHLDTVFSFCDRDLVTVFPEVVNQ
IVPFTLRPDESKPHGIDIQREKTNFLETVAAALNLKALRVVETGGNSFAAEREQWDDGNN
VVAVEPGVVIGYDRNTYTNTLLRKAGVEVITISAGELGRGRGGGHCMTCPIIRDPIDY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory