SitesBLAST
Comparing GFF440 FitnessBrowser__Marino:GFF440 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A9C5 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Escherichia coli (strain K12) (see 3 papers)
69% identity, 99% coverage: 4:467/467 of query aligns to 6:469/469 of P0A9C5
- Y398 (= Y396) modified: O-AMP-tyrosine
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
P0A1P6 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
68% identity, 99% coverage: 4:467/467 of query aligns to 6:469/469 of P0A1P6
1fpyA Crystal structure of glutamine synthetase from salmonella typhimurium with inhibitor phosphinothricin (see paper)
68% identity, 99% coverage: 4:467/467 of query aligns to 5:468/468 of 1fpyA
- binding adenosine-5'-diphosphate: G127 (= G126), E129 (= E128), E207 (= E206), T223 (≠ V222), F225 (≠ A224), H271 (= H270), S273 (= S272), R355 (= R354), E357 (= E356)
- binding manganese (ii) ion: E129 (= E128), E131 (= E130), E212 (= E211), E220 (= E219), H269 (= H268), E357 (= E356)
- binding phosphinothricin: E131 (= E130), E212 (= E211), G265 (= G264), H269 (= H268), R321 (= R320), E327 (= E326), R359 (= R358)
1f1hA Crystal structure of glutamine synthetase from salmonella typhimurium with thallium ions (see paper)
68% identity, 99% coverage: 4:467/467 of query aligns to 5:468/468 of 1f1hA
- binding adenosine-5'-diphosphate: E129 (= E128), E207 (= E206), H210 (= H209), E220 (= E219), T223 (≠ V222), F225 (≠ A224), H271 (= H270), S273 (= S272), R355 (= R354)
- binding manganese (ii) ion: E129 (= E128), E131 (= E130), E212 (= E211), E220 (= E219), H269 (= H268), E357 (= E356)
2lgsA Feedback inhibition of fully unadenylylated glutamine synthetase from salmonella typhimurium by glycine, alanine, and serine (see paper)
64% identity, 99% coverage: 4:467/467 of query aligns to 5:445/445 of 2lgsA
- binding glutamic acid: E125 (= E130), N258 (= N263), G259 (= G264), G261 (= G266), H263 (= H268), R315 (= R320), R349 (= R358)
- binding manganese (ii) ion: E123 (= E128), E125 (= E130), E206 (= E211), E214 (= E219), H263 (= H268), E347 (= E356)
1lgrA Interactions of nucleotides with fully unadenylylated glutamine synthetase from salmonella typhimurium (see paper)
64% identity, 99% coverage: 4:467/467 of query aligns to 5:445/445 of 1lgrA
- binding adenosine monophosphate: E201 (= E206), T217 (≠ V222), F219 (≠ A224), H265 (= H270), S267 (= S272), R345 (= R354)
- binding manganese (ii) ion: E123 (= E128), E125 (= E130), E206 (= E211), E214 (= E219), H263 (= H268), E347 (= E356)
P77961 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Synechocystis sp. (strain PCC 6803 / Kazusa)
51% identity, 100% coverage: 2:467/467 of query aligns to 6:473/473 of P77961
- E134 (= E130) binding
- E215 (= E211) binding
- E223 (= E219) binding
- E361 (= E356) binding
A0R079 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
53% identity, 98% coverage: 7:465/467 of query aligns to 12:476/478 of A0R079
- K14 (= K9) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
3ng0A Crystal structure of glutamine synthetase from synechocystis sp. Pcc 6803
50% identity, 100% coverage: 2:467/467 of query aligns to 4:465/465 of 3ng0A
- active site: D51 (= D49), E130 (= E128), E132 (= E130), E213 (= E211), E221 (= E219), H270 (= H268), R340 (= R338), E359 (= E356), R361 (= R358)
- binding phosphoaminophosphonic acid-adenylate ester: Y126 (≠ L124), E130 (= E128), K209 (≠ V207), I224 (≠ V222), F226 (≠ A224), H272 (= H270), S274 (= S272), R340 (= R338), R345 (= R343), R357 (= R354)
- binding manganese (ii) ion: E130 (= E128), E132 (= E130), E213 (= E211), E221 (= E219), H270 (= H268), E359 (= E356), R361 (= R358)
2whiA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a purine analogue inhibitor and l-methionine-s- sulfoximine phosphate. (see paper)
52% identity, 98% coverage: 7:465/467 of query aligns to 10:474/476 of 2whiA
- active site: D52 (= D49), E131 (= E128), E133 (= E130), E217 (= E211), E225 (= E219), H274 (= H268), R345 (= R338), E364 (= E356), R366 (= R358)
- binding 1-(3,4-dichlorobenzyl)-3,7-dimethyl-8-morpholin-4-yl-3,7-dihydro-1H-purine-2,6-dione: Y127 (≠ L124), G129 (= G126), F230 (≠ A224), H276 (= H270), S278 (= S272), W280 (≠ S274), K359 (= K351), R362 (= R354)
- binding magnesium ion: E131 (= E128), E131 (= E128), E133 (= E130), E217 (= E211), E225 (= E219), E225 (= E219), H274 (= H268), E364 (= E356)
- binding l-methionine-s-sulfoximine phosphate: E131 (= E128), E133 (= E130), E217 (= E211), E225 (= E219), G270 (= G264), H274 (= H268), R327 (= R320), E333 (= E326), R345 (= R338), R366 (= R358)
- binding phosphate ion: E131 (= E128), R350 (= R343), E364 (= E356)
1htoA Crystallographic structure of a relaxed glutamine synthetase from mycobacterium tuberculosis (see paper)
52% identity, 98% coverage: 7:465/467 of query aligns to 11:475/477 of 1htoA
- active site: D53 (= D49), E132 (= E128), E134 (= E130), E218 (= E211), E226 (= E219), H275 (= H268), R346 (= R338), E365 (= E356), R367 (= R358)
- binding adenosine monophosphate: Y128 (≠ L124), G130 (= G126), E132 (= E128), F231 (≠ A224), H277 (= H270), S279 (= S272), R363 (= R354)
- binding manganese (ii) ion: E132 (= E128), H275 (= H268), E365 (= E356)
4acfA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with imidazopyridine inhibitor ((4-(6-bromo-3- (butylamino)imidazo(1,2-a)pyridin-2-yl)phenoxy) acetic acid) and l- methionine-s-sulfoximine phosphate.
52% identity, 98% coverage: 7:465/467 of query aligns to 9:473/475 of 4acfA
- active site: D51 (= D49), E130 (= E128), E132 (= E130), E216 (= E211), E224 (= E219), H273 (= H268), R344 (= R338), E363 (= E356), R365 (= R358)
- binding {4-[6-bromo-3-(butylamino)imidazo[1,2-a]pyridin-2-yl]phenoxy}acetic acid: Y126 (≠ L124), F229 (≠ A224), H275 (= H270), Q276 (≠ M271), W279 (≠ S274), N356 (vs. gap), K358 (= K351), R361 (= R354)
- binding magnesium ion: E130 (= E128), E130 (= E128), E132 (= E130), E216 (= E211), E224 (= E219), E224 (= E219), H273 (= H268), E363 (= E356)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E128), E132 (= E130), E216 (= E211), E224 (= E219), G269 (= G264), H273 (= H268), R326 (= R320), E332 (= E326), R344 (= R338), R365 (= R358)
3zxvA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with tri-substituted imidazole inhibitor (4-(2-tert-butyl- 4-(6-methoxynaphthalen-2-yl)-1h-imidazol-5-yl)pyridin-2-amine) and l- methionine-s-sulfoximine phosphate (see paper)
52% identity, 98% coverage: 7:465/467 of query aligns to 9:473/475 of 3zxvA
- active site: D51 (= D49), E130 (= E128), E132 (= E130), E216 (= E211), E224 (= E219), H273 (= H268), R344 (= R338), E363 (= E356), R365 (= R358)
- binding magnesium ion: E130 (= E128), E130 (= E128), E132 (= E130), E216 (= E211), E224 (= E219), E224 (= E219), H273 (= H268), E363 (= E356)
- binding 4-(2-tert-butyl-4-(6-methoxynaphthalen-2-yl)-3h-imidazol-4-yl)pyridin-2-amine: Y126 (≠ L124), G128 (= G126), F229 (≠ A224), H275 (= H270), S277 (= S272), K358 (= K351), R361 (= R354)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E128), E132 (= E130), E216 (= E211), E224 (= E219), G269 (= G264), H273 (= H268), R326 (= R320), E332 (= E326), R344 (= R338), R365 (= R358)
3zxrA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with tri-substituted imidazole inhibitor (3-(2-tert-butyl- 5-(pyridin-4-yl)-1h-imidazol-4-yl)quinoline) and l-methionine-s- sulfoximine phosphate. (see paper)
52% identity, 98% coverage: 7:465/467 of query aligns to 9:473/475 of 3zxrA
- active site: D51 (= D49), E130 (= E128), E132 (= E130), E216 (= E211), E224 (= E219), H273 (= H268), R344 (= R338), E363 (= E356), R365 (= R358)
- binding 3-(2-tert-butyl-5-(pyridin-4-yl)-1h-imidazol-4-yl)quinoline: G128 (= G126), F229 (≠ A224), H275 (= H270), S277 (= S272), R361 (= R354)
- binding magnesium ion: E130 (= E128), E130 (= E128), E132 (= E130), E216 (= E211), E224 (= E219), E224 (= E219), H273 (= H268), E363 (= E356)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E128), E132 (= E130), E216 (= E211), E224 (= E219), H273 (= H268), R326 (= R320), E332 (= E326), R344 (= R338), R365 (= R358)
2bvcA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a transition state mimic (see paper)
52% identity, 98% coverage: 7:465/467 of query aligns to 9:473/475 of 2bvcA
- active site: D51 (= D49), E130 (= E128), E132 (= E130), E216 (= E211), E224 (= E219), H273 (= H268), R344 (= R338), E363 (= E356), R365 (= R358)
- binding adenosine-5'-diphosphate: E130 (= E128), E211 (= E206), K212 (≠ V207), N226 (≠ G221), F229 (≠ A224), H275 (= H270), S277 (= S272), R344 (= R338), R349 (= R343), R361 (= R354), E363 (= E356)
- binding magnesium ion: E130 (= E128), E130 (= E128), E132 (= E130), E216 (= E211), E224 (= E219), E224 (= E219), H273 (= H268), E363 (= E356)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E128), E132 (= E130), E216 (= E211), E224 (= E219), G269 (= G264), H273 (= H268), R326 (= R320), E332 (= E326), R344 (= R338), R365 (= R358)
P9WN39 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I beta; GSI beta; EC 6.3.1.2 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 5 papers)
52% identity, 98% coverage: 7:465/467 of query aligns to 12:476/478 of P9WN39
- E133 (= E128) binding
- E135 (= E130) binding
- E219 (= E211) binding
- E227 (= E219) binding
- H276 (= H268) binding
- E366 (= E356) binding
- Y406 (= Y396) modified: O-AMP-tyrosine; mutation to F: Unable to be adenylylated.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
4xycA Nanomolar inhibitors of mycobacterium tuberculosis glutamine synthetase 1: synthesis, biological evaluation and x-ray crystallographic studies (see paper)
51% identity, 98% coverage: 7:465/467 of query aligns to 9:464/466 of 4xycA
- active site: D51 (= D49), E121 (= E128), E123 (= E130), E207 (= E211), E215 (= E219), H264 (= H268), R335 (= R338), E354 (= E356), R356 (= R358)
- binding 9-phenyl-4H-imidazo[1,2-a]indeno[1,2-e]pyrazin-4-one: Y117 (≠ L124), F220 (≠ A224), H266 (= H270), S268 (= S272), W270 (≠ S274), K349 (= K351), A350 (= A352), R352 (= R354)
2wgsA Crystal structure of mycobacterium tuberculosis glutamine synthetase in complex with a purine analogue inhibitor. (see paper)
51% identity, 98% coverage: 7:465/467 of query aligns to 9:461/463 of 2wgsA
- active site: D51 (= D49), E126 (= E128), E128 (= E130), E212 (= E211), E220 (= E219), H269 (= H268), R340 (= R338), E359 (= E356), R361 (= R358)
- binding 1-(3,4-dichlorobenzyl)-3,7-dimethyl-8-morpholin-4-yl-3,7-dihydro-1H-purine-2,6-dione: Y122 (≠ L124), G124 (= G126), E126 (= E128), N222 (≠ G221), F225 (≠ A224), H271 (= H270), S273 (= S272), W275 (≠ S274), K354 (= K351), R357 (= R354)
4s17A The crystal structure of glutamine synthetase from bifidobacterium adolescentis atcc 15703
51% identity, 98% coverage: 7:465/467 of query aligns to 10:450/452 of 4s17A
- active site: D52 (= D49), E127 (= E128), E129 (= E130), E213 (= E211), E221 (= E219), H270 (= H268), R339 (= R338), E353 (= E356), R355 (= R358)
- binding magnesium ion: E129 (= E130), E213 (= E211), E221 (= E219)
5zlpJ Crystal structure of glutamine synthetase from helicobacter pylori (see paper)
48% identity, 99% coverage: 6:467/467 of query aligns to 14:478/478 of 5zlpJ
- binding adenosine-5'-diphosphate: Y132 (≠ L124), E136 (= E128), F215 (≠ E206), F232 (≠ A224), H278 (= H270), S280 (= S272), R351 (= R343), R362 (= R354)
- binding magnesium ion: E138 (= E130), E220 (= E211), E227 (= E219)
- binding phosphinothricin: E138 (= E130), E220 (= E211), G272 (= G264), H276 (= H268), E334 (= E326), R346 (= R338), R366 (= R358)
Query Sequence
>GFF440 FitnessBrowser__Marino:GFF440
MSKTVDLIKEHEVKWVDLRFTDSRGKEQHVTLPATEVDEDFFADGKMFDGSSIAGWKGIN
ESDMILMPDDETSVLDPFTEETTVNITCNIVEPSTMQGYERDPRSVARRAEEYLKSTGIA
DGALFGPEPEFFVFDSVKWNVDMQGAMYHIHSEEAAWVSGEDFDRNNIGHRPGVKGGYFP
VPPVDSLHDLRGAMCAAMESMGLDIEVHHHEVGTAGQCEIGVGANTLTKKADEVQILKYC
VHNVAHAYGKTATFMPKPVVGDNGSGMHVHMSLSKDGKNLFAGDSYAGLSEAALYYIGGV
IKHAKAINAFTNSSTNSYKRLVPGFEAPVMLAYSARNRSASIRIPYVNSPKARRIEVRFP
DPSANPYLAFAALMMAGLDGIQNKIHPGDAMDKDLYDLPKEEALSIPTVAETLSEALDCL
EADHEFLTRGGVFTEDMIAGYVGLKRGEVEKLNMTTHPIEFDLYYSC
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory