SitesBLAST – Find functional sites

 

SitesBLAST

Comparing GFF4424 FitnessBrowser__WCS417:GFF4424 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 15 hits to proteins with known functional sites (download)

A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
29% identity, 36% coverage: 88:244/439 of query aligns to 63:202/446 of A0A0H2VG78

query
sites
A0A0H2VG78
G
 
G
L
 
P
Y
 
L
A
 
A
D
 
D
K
 
K
V
 
L
G
 
G
R
 
R
K
 
R
K
 
R
A
 
L
L
 
V
M
 
M
A
 
L
S
 
I
V
 
A
Y
 
I
L
 
V
M
 
F
C
 
I
F
 
I
G
 
G
S
 
A
L
 
L
L
 
I
I
 
L
A
 
A
L
 
A
S
 
S
P
 
T
G
 
N
Y
 
L
E
 
A
I
 
-
I
 
-
G
 
-
I
 
-
G
 
-
A
 
-
P
 
-
I
 
-
L
 
L
L
 
L
V
 
I
F
 
I
A
 
G
R
|
R
L
 
L
L
 
I
Q
x
I
G
 
G
L
 
L
S
 
A
V
 
V
G
 
G
G
 
G
E
 
S
Y
 
M
G
 
S
T
 
T
S
 
V
A
 
P
T
 
V
Y
 
Y
L
 
L
S
 
S
E
|
E
M
 
M
A
 
A
T
 
P
K
 
T
E
 
E
R
 
Y
R
 
R
G
 
G
F
 
S
Y
 
L
S
 
G
S
 
S
F
 
L
Q
 
N
Y
x
Q
V
 
L
T
 
M
L
 
I
I
 
T
S
 
I
G
 
G
Q
 
I
L
 
L
I
 
A
A
 
A
L
 
Y
A
 
L
V
 
V
L
 
N
I
 
Y
V
 
A
L
 
F
Q
 
A
Q
 
D
V
 
I
L
 
-
T
 
-
T
 
-
E
 
-
Q
 
-
L
 
-
Y
 
-
A
 
-
W
 
E
G
 
G
W
 
W
R
 
R
I
 
W
P
 
M
F
 
L
A
 
G
I
 
L
G
 
A
A
 
V
L
 
V
C
 
P
A
 
S
V
 
V
V
 
I
A
 
L
L
 
L
Y
 
V
L
 
G
R
 
I
R
 
Y
G
 
F
M
 
M
E
 
P
E
 
E
T
 
S
E
 
P
S
 
R
F
 
W
T
 
L
K
 
L
K
 
E
E
 
N
K
 
R
A
 
N
K
 
E
E
 
E
S
 
A
A
 
A
M
 
-
R
 
R
T
 
Q
L
 
V
M
 
M
R
 
K

Sites not aligning to the query:

Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 35% coverage: 82:235/439 of query aligns to 98:258/583 of Q9Y7Q9

query
sites
Q9Y7Q9
I
 
M
G
 
G
G
 
Q
W
 
L
L
 
L
M
 
F
G
 
G
L
 
F
Y
 
L
A
 
G
D
 
D
K
 
F
V
 
F
G
 
G
R
 
R
K
 
K
K
 
F
A
 
V
L
 
Y
M
 
G
A
 
K
S
 
E
V
 
M
Y
 
M
L
 
V
M
 
V
C
 
I
F
 
I
G
 
A
S
 
T
L
 
I
L
 
L
I
 
I
A
 
I
L
 
C
S
 
L
P
 
P
G
 
D
Y
 
-
E
 
R
I
 
I
I
 
P
G
 
T
I
 
P
G
 
T
A
 
A
P
 
K
I
 
M
L
 
M
L
 
W
V
 
L
F
 
F
A
 
A
-
 
F
R
 
R
L
 
V
L
 
M
Q
 
L
G
 
G
L
 
I
S
 
G
V
 
I
G
 
G
G
 
G
E
 
D
Y
 
Y
G
 
P
T
 
M
S
 
S
A
 
A
T
 
S
Y
 
I
L
 
T
S
 
S
E
 
E
M
 
Q
A
 
S
T
 
L
K
 
I
E
 
N
R
 
R
R
 
R
G
 
G
-
 
A
-
 
L
-
 
L
-
 
A
-
 
W
F
 
I
Y
 
F
S
 
S
S
 
N
F
 
Q
Q
 
G
Y
 
W
V
 
G
T
 
T
L
 
L
I
 
-
S
 
A
G
 
G
Q
 
C
L
 
V
I
 
A
A
 
T
L
 
L
A
 
I
V
 
I
L
 
L
I
 
A
V
 
C
L
 
F
Q
 
E
Q
 
K
V
 
P
L
 
L
T
 
N
T
 
D
E
 
R
Q
 
G
L
 
E
Y
 
Y
A
 
T
-
 
K
-
 
L
-
 
N
W
 
G
G
 
V
W
 
W
R
 
R
I
 
I
P
 
Q
F
 
F
A
 
G
I
 
I
G
 
A
A
 
L
L
 
F
C
 
P
A
 
A
V
 
V
V
 
I
A
 
V
L
 
L
Y
 
I
L
 
P
R
 
R
R
 
L
G
 
R
M
 
M
E
 
Q
E
 
E
T
 
S
E
 
E
S
 
Q
F
 
F
T
 
K
K
 
N
K
 
S
E
 
K
K
 
N
A
 
M
K
 
K

Sites not aligning to the query:

P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 70% coverage: 78:384/439 of query aligns to 186:499/616 of P36035

query
sites
P36035
L
 
F
M
 
V
R
 
R
P
 
S
I
 
A
G
 
G
G
 
A
W
 
V
L
 
I
M
 
F
G
 
G
L
 
L
Y
 
W
A
 
T
D
 
D
K
 
K
V
 
S
G
 
S
R
 
R
K
 
K
K
 
W
A
 
P
L
 
Y
M
 
I
A
 
T
S
 
C
V
 
L
Y
 
F
L
 
L
M
 
F
C
 
V
F
 
I
G
 
A
S
 
Q
L
 
L
L
 
C
I
 
T
A
 
P
L
 
W
S
 
C
P
 
D
G
 
T
Y
 
Y
E
 
E
-
 
K
I
 
F
I
 
L
G
 
G
I
 
V
G
 
-
A
 
-
P
 
-
I
 
-
L
 
-
L
 
-
V
 
-
F
 
-
A
 
-
R
 
R
L
 
W
L
 
I
Q
 
T
G
 
G
L
 
I
S
 
A
V
 
M
G
 
G
G
 
G
E
 
I
Y
 
Y
G
 
G
T
 
C
S
 
A
A
 
S
T
 
A
Y
 
T
L
 
A
S
 
I
E
 
E
M
 
D
A
 
A
T
 
P
K
 
V
E
 
K
R
 
A
R
 
R
G
 
S
F
 
F
Y
 
L
S
 
S
S
 
G
F
 
L
Q
 
F
Y
 
F
V
 
S
T
 
A
L
 
Y
I
 
A
S
 
M
G
 
G
Q
 
F
L
 
I
I
 
F
A
 
A
L
 
I
A
 
I
V
 
F
L
 
Y
I
 
R
V
 
A
L
 
F
Q
 
G
Q
 
Y
V
 
F
L
 
R
T
 
D
T
 
D
E
 
-
Q
 
-
L
 
-
Y
 
-
A
 
-
W
 
-
G
 
G
W
 
W
R
 
K
I
 
I
P
 
L
F
 
F
A
 
W
I
 
F
G
 
S
A
 
I
L
 
F
C
 
L
A
 
P
V
 
I
V
 
L
A
 
L
L
 
I
Y
 
F
L
 
W
R
 
R
R
 
L
G
 
L
M
 
W
E
 
P
E
 
E
T
 
T
E
 
K
S
 
Y
F
 
F
T
 
T
K
 
K
K
 
V
E
 
L
K
 
K
A
 
A
K
 
R
E
 
K
S
 
L
A
 
I
M
 
L
R
 
S
T
 
D
L
 
A
M
 
V
R
x
K
H
 
A
-
 
N
-
 
G
-
 
G
-
 
E
-
 
P
-
 
L
P
 
P
K
 
K
E
 
A
L
 
N
L
 
F
T
 
K
V
 
Q
V
 
K
G
 
M
L
 
V
T
 
S
M
 
M
G
 
K
G
 
R
T
 
T
L
 
V
A
 
Q
F
 
K
Y
 
Y
-
 
W
-
 
L
-
 
L
-
 
F
-
 
A
-
 
Y
-
 
L
-
 
V
-
 
V
-
 
L
-
 
L
-
 
V
-
 
G
-
 
P
T
 
N
Y
 
Y
T
 
L
T
 
T
Y
 
H
M
 
A
Q
 
S
K
 
Q
Y
 
D
L
 
L
V
 
L
N
 
P
T
 
T
-
 
M
-
 
L
-
 
R
-
 
A
-
 
Q
V
 
L
G
 
G
M
 
L
S
 
S
I
 
K
S
 
D
D
 
A
S
 
V
T
 
T
T
 
V
I
 
I
S
 
V
A
 
V
A
 
V
T
 
T
L
 
N
F
 
I
L
 
G
F
 
A
M
 
I
C
 
C
L
 
G
Q
 
G
P
 
M
I
 
I
V
 
F
G
 
G
G
 
Q
L
 
F
S
 
M
D
 
E
K
 
V
V
 
T
G
 
G
R
 
R
R
 
R
P
 
L
I
 
G
L
 
L
I
 
L
A
 
I
F
 
A
G
 
C
I
 
T
L
 
M
G
 
G
T
 
G
L
 
C
F
 
F
T
 
T
V
 
Y
P
 
P
I
 
A
L
 
F
T
 
-
T
 
M
L
 
L
H
 
R
T
 
S
I
 
E
Q
 
K
S
 
A
W
 
I
W
 
L
G
 
G
A
 
A
F
 
G
F
 
F
L
 
M
I
 
L
M
 
Y
A
 
F
A
 
C
L
 
V
I
 
F
I
 
G
V
 
V
S
 
W
G
 
G
Y
 
I
T
 
L
S
 
P
I
 
I
N
 
H
A
 
L
V
 
-
V
 
-
K
 
-
A
 
A
E
 
E
L
 
L
F
 
A
P
 
P
T
 
A
E
 
D
I
 
A
R
 
R
A
 
A
L
 
L
G
 
V
V
 
A
G
 
G
L
 
L
P
 
S
Y
 
Y
A
 
Q
L
 
L

Sites not aligning to the query:

Q6PXP3 Solute carrier family 2, facilitated glucose transporter member 7; Glucose transporter type 7; GLUT-7; hGLUT7 from Homo sapiens (Human) (see paper)
20% identity, 77% coverage: 92:431/439 of query aligns to 100:470/512 of Q6PXP3

query
sites
Q6PXP3
D
 
D
K
 
S
V
 
C
G
 
G
R
 
R
K
 
K
K
 
G
A
 
T
L
 
L
M
 
L
A
 
I
S
 
N
V
 
N
Y
 
I
L
 
F
M
 
A
C
 
I
F
 
I
G
 
P
S
 
A
L
 
I
L
 
L
I
 
M
A
 
G
L
 
V
S
 
S
P
 
K
-
 
V
-
 
A
-
 
K
G
 
A
Y
 
F
E
 
E
I
 
L
I
 
I
G
 
-
I
 
-
G
 
-
A
 
-
P
 
-
I
 
-
L
 
-
L
 
-
V
 
V
F
 
F
A
 
S
R
 
R
L
 
V
L
 
V
Q
 
L
G
 
G
L
 
V
S
 
C
V
 
A
G
 
G
G
 
I
E
 
S
Y
 
Y
G
 
S
T
 
A
S
 
L
A
 
P
T
 
M
Y
 
Y
L
 
L
S
 
G
E
 
E
M
 
L
A
 
A
T
 
P
K
 
K
E
 
N
R
 
L
R
 
R
G
 
G
F
 
M
Y
 
V
S
 
G
S
 
T
F
 
M
Q
 
T
Y
 
E
V
 
V
T
 
F
L
 
V
I
 
I
S
 
V
G
 
G
Q
 
-
L
 
-
I
 
V
A
 
F
L
 
L
A
 
A
V
 
Q
L
 
I
I
 
F
V
 
S
L
 
L
Q
 
Q
Q
 
A
V
 
I
L
 
L
T
 
G
T
 
N
E
 
P
Q
 
A
L
 
-
Y
 
-
A
 
-
W
 
-
G
 
G
W
 
W
R
 
P
I
 
V
P
 
L
F
 
L
A
 
A
I
 
L
G
 
T
A
 
G
L
 
V
C
 
P
A
 
A
V
 
L
V
 
L
A
 
Q
L
 
L
Y
 
L
L
 
T
R
 
L
R
 
P
G
 
F
M
 
F
E
 
P
E
 
E
T
 
S
E
 
P
S
 
R
F
 
Y
T
 
S
K
 
L
K
 
I
E
 
Q
K
 
K
A
 
G
K
 
D
E
 
E
S
 
A
A
 
T
M
 
A
R
 
R
T
 
Q
L
 
A
M
 
L
R
 
R
H
 
R
P
 
L
K
 
R
-
 
G
-
 
H
-
 
T
-
 
D
-
 
M
-
 
E
-
 
A
-
 
E
-
 
L
-
 
E
-
 
D
-
 
M
-
 
R
-
 
A
-
 
E
-
 
A
-
 
R
-
 
A
-
 
E
-
 
R
-
 
A
-
 
E
-
 
G
-
 
H
-
 
L
-
 
S
-
 
V
-
 
L
-
 
H
-
 
L
-
 
C
-
 
A
-
 
L
-
 
R
-
 
S
-
 
L
-
 
R
-
 
W
E
 
Q
L
 
L
L
 
L
T
 
S
V
 
I
V
 
I
G
 
V
L
 
L
T
 
M
M
 
A
G
 
G
G
 
Q
T
 
Q
L
 
L
A
 
S
F
 
G
Y
 
I
T
 
N
Y
 
A
T
x
I
T
 
N
Y
 
Y
M
 
Y
Q
 
A
K
 
D
Y
 
T
L
 
I
V
 
Y
N
 
T
T
 
S
V
 
A
G
 
G
M
 
V
S
 
E
I
 
A
S
 
A
D
 
H
S
 
S
-
 
Q
-
 
Y
T
 
V
T
 
T
I
 
V
S
 
G
A
 
S
A
 
G
T
 
V
L
 
V
F
 
N
L
 
I
F
 
V
M
 
M
C
 
T
L
 
I
Q
 
T
P
 
S
I
 
A
V
 
V
G
 
-
G
 
-
L
 
L
S
 
V
D
 
E
K
 
R
V
 
L
G
 
G
R
 
R
R
 
R
P
 
H
I
 
L
L
 
L
I
 
L
A
 
A
-
 
G
F
 
Y
G
 
G
I
 
I
L
 
C
G
 
G
T
 
S
L
 
A
F
 
C
T
 
L
V
 
V
P
 
L
I
 
T
L
 
V
T
 
V
T
 
L
L
 
L
H
 
F
T
 
Q
I
 
N
Q
 
R
S
 
V
W
 
P
W
 
E
G
 
L
A
 
S
F
 
Y
F
 
L
L
 
G
I
 
I
M
 
I
A
 
C
A
 
V
L
 
F
I
 
A
I
 
Y
V
 
I
S
 
A
G
 
G
Y
 
H
-
 
S
-
 
I
-
 
G
-
 
P
T
 
S
S
 
P
I
 
V
N
 
P
A
 
S
V
 
V
V
 
V
K
 
R
A
 
T
E
 
E
L
 
I
F
 
F
P
 
L
T
 
Q
E
 
S
I
 
S
R
 
R
A
 
R
L
 
A
G
 
A
V
 
-
G
 
-
L
 
-
P
 
-
Y
 
F
A
 
M
L
 
V
T
 
D
V
 
G
S
 
A
I
 
V
F
 
H
G
 
W
G
 
L
T
 
T
A
 
N
E
 
F
Y
 
I
I
 
I
A
 
G
L
 
F
W
 
L
F
 
F
K
 
P
S
 
S
I
 
I
G
 
Q
M
 
E
E
 
A
T
 
I
G
 
G
Y
 
A
Y
 
Y
W
 
S
Y
 
F
V
 
I
T
 
I
-
 
F
-
 
A
-
 
G
A
 
I
C
 
C
I
 
L
A
 
L
V
 
T
S
 
A
L
 
I
A
 
Y
V
 
I
Y
 
Y
V
 
V
T
 
V
M
 
I
K
 
P
D
 
E
T
 
T
R
 
K

O42885 Putative inorganic phosphate transporter C8E4.01c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 54% coverage: 3:238/439 of query aligns to 18:270/572 of O42885

query
sites
O42885
N
 
N
S
 
D
N
 
D
S
 
A
L
 
V
P
 
P
L
 
L
G
 
D
S
 
Q
A
 
V
A
 
E
A
 
E
P
 
G
A
 
A
K
 
Q
A
 
E
R
 
R
T
 
R
-
 
Y
-
 
Y
-
 
L
-
 
G
-
 
L
T
 
T
S
 
K
S
 
R
R
 
E
I
 
F
K
 
K
S
 
L
I
 
M
F
 
M
S
 
L
G
 
A
S
 
G
V
 
V
G
 
G
N
 
F
M
 
F
V
 
L
E
 
D
W
 
S
Y
 
Y
D
 
D
W
 
L
Y
 
F
V
 
I
Y
 
I
A
 
N
A
 
L
F
 
V
S
 
T
L
 
P
Y
 
I
F
 
F
-
 
E
-
 
Y
-
 
L
-
 
Y
-
 
W
-
 
G
-
 
G
-
 
I
-
 
E
-
 
K
-
 
G
-
 
P
-
 
T
A
 
G
K
 
K
A
 
G
F
 
H
F
 
Y
P
 
P
K
 
S
G
 
G
D
 
-
T
 
-
T
 
I
A
 
R
Q
 
G
L
 
L
L
 
V
N
 
N
T
 
A
A
 
S
A
 
A
I
 
N
F
 
I
A
 
G
V
 
N
G
 
I
F
 
F
L
 
-
M
 
-
R
 
-
P
 
-
I
 
-
G
 
G
G
 
Q
W
 
L
L
 
L
M
 
F
G
 
G
L
 
F
Y
 
M
A
 
G
D
 
D
K
 
F
V
 
F
G
 
G
R
 
R
K
 
K
K
 
F
A
 
V
L
 
Y
M
 
G
A
 
K
S
 
E
V
 
M
Y
 
V
L
 
I
M
 
V
C
 
I
F
 
I
G
 
A
S
 
T
L
 
V
L
 
L
I
 
V
A
 
I
L
 
A
S
 
M
P
 
P
G
 
K
Y
 
-
E
 
-
I
 
-
I
 
-
G
 
S
I
 
I
G
 
H
A
 
S
P
 
P
I
 
L
-
 
S
-
 
K
-
 
M
L
 
M
L
 
W
V
 
V
F
 
F
A
 
C
-
 
W
R
 
R
L
 
W
L
 
L
Q
 
L
G
 
G
L
 
V
S
 
G
V
 
I
G
 
G
G
 
G
E
 
D
Y
 
Y
G
 
P
T
 
M
S
 
S
A
 
A
T
 
A
Y
 
I
L
 
T
S
 
S
E
 
E
M
 
R
A
 
S
T
 
K
K
 
I
E
 
K
R
 
R
R
 
R
G
 
G
F
 
T
Y
 
L
S
 
I
S
 
S
-
 
L
-
 
I
-
 
F
-
 
A
F
 
F
Q
 
Q
Y
 
G
V
 
F
T
 
G
L
 
T
I
 
L
S
 
A
G
 
G
Q
 
A
L
 
I
I
 
V
A
 
T
L
 
I
A
 
I
V
 
L
L
 
L
I
 
G
V
 
C
L
 
F
Q
 
E
Q
 
H
V
 
P
L
 
L
T
 
N
T
 
R
E
 
E
Q
 
G
L
 
H
Y
 
Y
-
 
H
-
 
K
-
 
L
A
 
E
W
 
G
G
 
V
W
 
W
R
 
R
I
 
L
P
 
Q
F
 
F
A
 
G
I
 
L
G
 
A
A
 
L
L
 
V
C
 
P
A
 
A
V
 
I
V
 
G
A
 
V
L
 
L
Y
 
I
L
 
P
R
 
R
R
 
L
G
 
I
M
 
M
E
 
K
E
 
E
T
 
S
E
 
K
S
 
S
F
 
Y
T
 
-
K
 
E
K
 
N
E
 
S
K
 
K
A
 
A
K
 
L
E
 
N
S
 
S
A
 
A

Sites not aligning to the query:

Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 35% coverage: 92:244/439 of query aligns to 93:230/580 of Q9C757

query
sites
Q9C757
D
 
D
K
 
K
V
 
L
G
 
G
R
 
R
K
 
R
K
 
S
A
 
A
L
 
I
M
 
L
A
 
M
S
 
A
V
 
D
Y
 
F
L
 
L
M
 
F
C
 
L
F
 
L
G
 
G
S
 
A
L
 
I
L
 
I
I
 
M
A
 
A
L
 
A
S
 
A
P
 
P
G
 
N
Y
 
-
E
 
-
I
 
-
I
 
-
G
 
-
I
 
-
G
 
-
A
 
-
P
 
P
I
 
S
L
 
L
L
 
L
V
 
V
F
 
V
A
 
G
R
 
R
L
 
V
L
 
F
Q
 
V
G
 
G
L
 
L
S
 
G
V
 
V
G
 
G
G
 
M
E
 
A
Y
 
S
G
 
M
T
 
T
S
 
A
A
 
P
T
 
L
Y
 
Y
L
 
I
S
 
S
E
 
E
M
 
A
A
 
S
T
 
P
K
 
A
E
 
K
R
 
I
R
 
R
G
 
G
F
 
A
Y
 
L
S
 
V
S
 
S
F
 
T
Q
 
N
Y
 
G
V
 
F
T
 
L
L
 
I
I
 
T
S
 
G
G
 
G
Q
 
Q
L
 
F
I
 
L
A
 
S
L
 
Y
A
 
L
V
 
I
L
 
N
I
 
L
V
 
A
L
 
F
Q
 
T
Q
 
D
V
 
V
L
 
T
T
 
G
T
 
T
E
 
-
Q
 
-
L
 
-
Y
 
-
A
 
-
W
 
-
G
 
-
W
 
W
R
 
R
I
 
W
P
 
M
F
 
L
A
 
G
I
 
I
G
 
A
A
 
G
L
 
I
C
 
P
A
 
A
V
 
L
V
 
L
A
 
Q
L
 
F
Y
 
V
L
 
L
R
 
M
R
 
F
G
 
T
M
 
L
E
 
P
E
 
E
T
 
S
E
 
P
S
 
R
F
 
W
T
 
L
K
 
Y
K
 
R
E
 
K
K
 
G
A
 
R
K
 
E
E
 
E
S
 
E
A
 
A
M
 
K
R
 
A
T
 
I
L
 
L
M
 
R
R
 
R

Sites not aligning to the query:

P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
26% identity, 35% coverage: 82:235/439 of query aligns to 117:283/587 of P25297

query
sites
P25297
I
 
I
G
 
G
G
 
Q
W
 
F
L
 
G
M
 
F
G
 
G
L
 
T
Y
 
L
A
 
A
D
 
D
K
 
I
V
 
V
G
 
G
R
 
R
K
 
K
K
 
R
A
 
I
L
 
Y
M
 
G
A
 
M
S
 
E
V
 
L
Y
 
I
L
 
I
M
 
M
C
 
I
F
 
V
G
 
C
S
 
T
L
 
I
L
 
L
-
 
Q
-
 
T
-
 
T
I
 
V
A
 
A
L
 
H
S
 
S
P
 
P
G
 
A
Y
 
I
E
 
N
I
 
F
I
 
V
G
 
A
I
 
V
G
 
-
A
 
-
P
 
-
I
 
-
L
 
-
L
 
L
V
 
T
F
 
F
A
 
Y
R
 
R
L
 
I
L
 
V
Q
 
M
G
 
G
L
 
I
S
 
G
V
 
I
G
 
G
G
 
G
E
 
D
Y
 
Y
G
 
P
T
 
L
S
 
S
A
 
S
T
 
I
Y
 
I
L
 
T
S
 
S
E
 
E
M
 
F
A
 
A
T
 
T
K
 
T
E
 
K
R
 
W
R
 
R
G
 
G
F
 
A
Y
 
I
S
 
M
S
 
G
F
 
A
Q
 
V
Y
 
F
V
 
A
T
 
N
L
 
Q
I
 
A
S
 
W
G
 
G
Q
 
Q
L
 
I
I
 
S
A
 
G
L
 
G
A
 
I
V
 
I
L
 
A
I
 
L
V
 
I
L
 
L
Q
 
V
Q
 
A
V
 
A
L
 
Y
T
 
K
T
 
G
E
 
E
Q
 
L
L
 
E
Y
 
Y
A
 
A
W
 
N
G
 
S
-
 
G
-
 
A
-
 
E
-
 
C
-
 
D
-
 
A
-
 
R
-
 
C
-
 
Q
-
 
K
-
 
A
-
 
C
-
 
D
-
 
Q
-
 
M
W
 
W
R
 
R
I
 
I
P
 
L
F
 
I
A
 
G
I
 
L
G
 
G
A
 
T
L
 
V
C
 
L
A
 
G
V
 
L
V
 
A
A
 
C
L
 
L
Y
 
Y
L
 
F
R
 
R
R
 
L
G
 
T
M
 
I
E
 
P
E
 
E
T
 
S
E
 
P
S
 
R
F
 
Y
T
 
Q
K
 
L
K
 
D
E
 
V
K
 
N
A
 
A
K
 
K

Sites not aligning to the query:

7sp5A Crystal structure of a eukaryotic phosphate transporter (see paper)
25% identity, 45% coverage: 24:219/439 of query aligns to 2:200/433 of 7sp5A

query
sites
7sp5A
R
 
Q
I
 
I
K
 
K
S
 
L
I
 
V
F
 
L
S
 
L
G
 
A
S
 
G
V
 
V
G
 
G
N
 
F
M
 
F
V
 
L
E
 
D
W
 
A
Y
 
Y
D
 
D
W
 
L
Y
 
F
V
 
I
Y
 
I
A
 
N
A
 
Q
F
 
V
S
 
A
L
 
P
Y
 
M
F
 
L
A
 
A
K
 
Q
A
 
V
F
 
Y
F
 
F
P
 
P
K
 
K
G
 
T
D
 
G
T
 
L
T
 
P
A
 
A
Q
 
Q
-
 
R
-
 
Q
-
 
D
L
 
L
L
 
M
N
 
K
T
 
A
A
 
A
A
 
A
I
 
-
F
 
-
A
 
N
V
 
I
G
 
G
F
 
C
L
 
V
M
 
-
R
 
-
P
 
-
I
 
V
G
 
G
G
 
Q
W
 
V
L
 
M
M
 
F
G
 
G
L
 
V
Y
 
L
A
 
G
D
 
D
K
 
S
V
 
F
G
 
G
R
 
R
K
 
K
K
 
F
A
 
V
L
 
Y
M
 
G
A
 
K
S
 
E
V
 
L
Y
 
I
L
 
L
M
 
I
C
 
I
F
 
V
G
 
A
S
 
T
L
 
I
L
 
F
I
 
Q
A
 
M
L
 
S
S
 
A
P
 
P
G
 
S
Y
 
H
E
 
W
I
 
D
I
 
-
G
 
-
I
 
-
G
 
G
A
 
N
P
 
R
I
 
V
L
 
L
-
 
T
-
 
W
L
 
I
V
 
T
F
 
I
A
 
C
R
 
R
L
 
V
L
 
F
Q
 
L
G
 
G
L
 
I
S
 
G
V
 
I
G
 
G
G
 
G
E
 
D
Y
|
Y
G
 
P
T
 
M
S
 
S
A
 
A
T
 
T
Y
 
V
L
 
V
S
 
S
E
 
D
M
 
R
A
 
A
T
 
N
K
 
I
E
 
H
R
 
R
R
 
R
G
 
G
F
 
T
Y
 
L
S
 
L
S
 
C
F
 
F
Q
 
I
Y
x
F
V
 
A
T
 
N
L
x
Q
I
 
G
S
 
W
G
 
G
Q
 
S
L
 
F
I
 
V
A
 
G
L
 
S
A
 
L
V
 
V
L
 
T
I
 
I
V
 
V
-
 
T
-
 
I
-
 
S
-
 
G
L
 
F
Q
 
K
Q
 
H
V
 
R
L
 
L
T
 
K
T
 
S
E
 
G
Q
 
H
L
 
T
Y
 
H
-
 
D
-
 
V
A
 
D
W
 
K
G
 
A
W
 
W
R
 
R
I
 
I
P
 
L
F
 
I
A
 
G
I
 
L
G
 
S
A
 
L
L
 
I
C
 
P
A
 
A
V
 
F
V
 
G
A
 
T
L
 
L
Y
 
Y
L
 
Q
R
 
R

Sites not aligning to the query:

Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
23% identity, 49% coverage: 21:233/439 of query aligns to 37:230/444 of Q8NLB7

query
sites
Q8NLB7
T
 
S
S
 
G
S
 
R
R
 
R
I
 
L
K
 
A
S
 
A
I
 
V
F
 
L
S
 
I
G
 
G
S
 
W
V
 
F
G
 
F
N
 
V
M
 
I
V
 
F
E
x
D
W
 
G
Y
 
Y
D
|
D
W
 
L
Y
 
I
V
 
V
Y
 
Y
A
 
G
A
 
T
F
 
V
S
 
Q
L
 
S
Y
 
A
F
 
L
A
 
A
K
 
K
A
 
E
F
 
W
F
 
N
P
 
L
K
 
S
G
 
S
D
 
A
T
 
T
T
 
L
A
 
G
Q
 
T
L
 
I
L
 
G
N
 
S
T
 
T
A
 
A
A
 
-
I
 
-
F
 
-
A
 
-
V
 
-
G
 
-
F
 
F
L
 
F
M
 
G
R
 
M
P
 
A
I
 
I
G
 
G
G
 
A
W
 
V
L
 
F
M
 
I
G
 
G
L
 
R
Y
 
L
A
 
S
D
 
D
K
x
R
V
 
V
G
 
G
R
 
R
K
 
K
K
 
A
A
 
A
L
 
V
M
 
I
A
 
G
S
 
S
V
 
V
Y
 
L
L
 
I
M
 
L
C
 
S
F
 
V
G
 
F
S
 
T
L
 
M
L
 
L
I
 
C
A
 
A
L
 
F
S
 
A
P
 
P
G
 
N
Y
 
P
E
 
W
I
 
V
I
 
F
G
 
G
I
 
A
G
 
-
A
 
-
P
 
-
I
 
-
L
 
-
L
 
-
V
 
-
F
 
-
A
 
F
R
 
R
L
 
F
L
 
I
Q
 
A
G
 
G
L
 
L
S
 
G
V
 
L
G
 
G
G
 
G
E
 
L
Y
 
V
G
 
P
T
 
S
S
 
V
A
 
N
T
 
A
Y
 
M
L
 
T
S
 
S
E
 
D
M
 
L
A
 
V
T
 
P
K
 
R
E
 
K
R
 
T
R
 
M
G
 
S
F
 
A
Y
 
W
S
 
A
S
 
T
F
 
-
Q
 
-
Y
 
-
V
 
-
T
 
V
L
 
M
I
 
M
S
 
S
G
 
G
Q
 
V
L
 
P
I
 
I
-
 
G
-
 
G
A
 
S
L
 
I
A
 
A
V
 
A
L
 
V
I
 
L
V
 
A
L
 
L
Q
 
V
Q
 
V
V
 
V
L
 
P
T
 
S
T
 
S
E
 
E
Q
 
E
L
 
-
Y
 
-
A
 
-
W
 
W
G
 
G
W
 
W
R
 
R
I
 
F
P
 
M
F
 
F
A
 
L
I
 
I
G
 
A
A
 
L
L
 
I
C
 
P
A
 
L
V
 
V
V
 
V
A
 
G
L
 
L
Y
 
P
L
 
I
R
 
A
R
 
M
G
 
K
M
 
V
E
 
I
E
 
P
T
 
S
E
 
D
S
 
K
F
 
A
T
 
I
K
 
K
K
 
A
E
 
D
K
 
H

Sites not aligning to the query:

Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
28% identity, 25% coverage: 58:168/439 of query aligns to 177:281/727 of Q496J9

query
sites
Q496J9
P
 
P
K
 
S
G
 
A
D
 
E
T
 
T
T
 
D
A
 
L
Q
 
C
L
 
I
L
 
P
N
 
N
T
 
S
A
 
G
A
 
S
-
 
G
-
 
W
I
 
L
F
 
G
A
 
S
V
 
I
G
 
V
F
 
Y
L
 
L
M
 
G
R
 
M
P
 
M
I
 
V
G
 
G
G
 
A
W
 
F
L
 
F
M
 
W
G
 
G
L
 
G
Y
 
L
A
 
A
D
 
D
K
 
K
V
 
V
G
 
G
R
 
R
K
 
K
K
 
Q
A
 
S
L
 
L
M
 
L
A
 
I
S
 
C
V
 
M
Y
 
S
L
 
V
M
 
N
C
 
G
F
 
F
G
 
F
S
 
A
L
 
F
L
 
L
I
 
S
A
 
S
L
 
F
S
 
V
P
 
Q
G
 
G
Y
 
Y
E
 
G
I
 
-
I
 
-
G
 
-
I
 
-
G
 
-
A
 
-
P
 
-
I
 
-
L
 
F
L
 
F
V
 
L
F
 
F
A
 
C
R
 
R
L
 
L
L
 
L
Q
 
S
G
 
G
L
 
F
S
 
G
V
 
I
G
 
G
G
 
G
E
 
A
Y
 
I
G
 
P
T
 
T
S
 
V
A
 
F
T
 
S
Y
 
Y
L
 
F
S
 
A
E
 
E
M
 
V
A
 
L
T
 
A
K
 
R
E
 
E
R
 
K
R
 
R
G
 
G
F
 
E
Y
 
H
S
 
L
S
 
S
F
 
W

Sites not aligning to the query:

P14142 Solute carrier family 2, facilitated glucose transporter member 4; GT2; Glucose transporter type 4, insulin-responsive; GLUT-4 from Mus musculus (Mouse) (see paper)
25% identity, 38% coverage: 15:180/439 of query aligns to 15:187/509 of P14142

query
sites
P14142
P
 
P
A
 
P
K
 
R
A
 
Q
R
 
R
T
 
V
T
 
T
S
 
G
S
 
T
R
 
L
I
 
V
K
 
L
S
 
A
I
 
V
F
 
F
S
 
S
G
 
A
S
 
V
V
 
L
G
 
G
N
 
S
M
 
L
V
 
Q
E
 
F
W
 
G
Y
 
Y
D
 
N
W
 
I
Y
 
G
V
 
V
Y
 
I
A
 
N
A
 
A
F
 
P
S
 
Q
L
 
K
Y
 
V
F
 
I
A
 
E
K
 
Q
A
 
S
F
 
Y
-
x
N
-
 
A
-
 
T
-
 
W
-
 
L
-
 
G
-
 
R
-
 
Q
-
 
G
-
 
P
-
 
G
-
 
G
-
 
P
-
 
D
-
 
S
F
 
I
P
 
P
K
 
Q
G
 
G
D
 
T
T
 
L
T
 
T
A
 
T
Q
 
L
L
 
W
L
 
A
N
 
L
T
 
S
A
 
V
A
 
A
I
 
I
F
 
F
A
 
S
V
 
V
G
 
G
F
 
G
L
 
M
M
 
-
R
 
-
P
 
-
I
 
I
G
 
S
G
 
S
W
 
F
L
 
L
M
 
I
G
 
G
L
 
I
Y
 
I
A
 
S
D
 
Q
K
 
W
V
 
L
G
 
G
R
 
R
K
 
K
K
 
R
A
 
A
L
 
M
M
 
L
A
 
A
S
 
N
V
 
N
Y
 
V
L
 
L
M
 
A
C
 
V
F
 
L
G
 
G
S
 
G
L
 
A
L
 
L
I
 
M
A
 
G
L
 
L
S
 
A
P
 
N
G
 
A
-
 
A
-
 
A
-
 
S
Y
 
Y
E
 
E
I
 
I
I
 
-
G
 
-
I
 
-
G
 
-
A
 
-
P
 
-
I
 
-
L
 
-
L
 
L
V
 
I
F
 
L
A
 
G
R
 
R
L
 
F
L
 
L
Q
 
I
G
 
G
L
 
A
S
 
Y
V
 
S
G
 
G
G
 
L
E
 
T
Y
 
S
G
 
G
T
 
L
S
 
V
A
 
P
T
 
M
Y
 
Y
L
 
V
S
 
G
E
 
E
M
 
I
A
 
A
T
 
P
K
 
T
E
 
H
R
 
L
R
 
R
G
 
G
F
 
A
Y
 
L
S
 
G
S
 
T
F
 
L
Q
 
N
Y
 
Q
V
 
L
T
 
A
L
 
I
I
 
V
S
 
I
G
 
G
Q
 
I
L
 
L
I
 
V
A
 
A

Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
27% identity, 25% coverage: 58:168/439 of query aligns to 177:281/727 of Q9Z2I6

query
sites
Q9Z2I6
P
 
P
K
 
S
G
 
A
D
 
E
T
 
T
T
 
D
A
 
L
Q
 
C
L
 
I
L
 
P
N
 
N
T
 
S
A
 
G
A
 
S
-
 
G
-
 
W
I
 
L
F
 
G
A
 
S
V
 
I
G
 
V
F
 
Y
L
 
L
M
 
G
R
 
M
P
 
M
I
 
V
G
 
G
G
 
A
W
 
F
L
 
F
M
 
W
G
 
G
L
 
G
Y
 
L
A
 
A
D
 
D
K
 
K
V
 
V
G
 
G
R
 
R
K
 
K
K
 
Q
A
 
S
L
 
L
M
 
L
A
 
I
S
 
C
V
 
M
Y
 
S
L
 
V
M
 
N
C
 
G
F
 
F
G
 
F
S
 
A
L
 
F
L
 
L
I
 
S
A
 
S
L
 
F
S
 
V
P
 
Q
G
 
G
Y
 
Y
E
 
G
I
 
-
I
 
-
G
 
-
I
 
-
G
 
-
A
 
-
P
 
-
I
 
-
L
 
F
L
 
F
V
 
L
F
 
L
A
 
C
R
 
R
L
 
L
L
 
L
Q
 
S
G
 
G
L
 
F
S
 
G
V
 
I
G
 
G
G
 
G
E
 
A
Y
 
I
G
 
P
T
 
T
S
 
V
A
 
F
T
 
S
Y
 
Y
L
 
F
S
 
A
E
 
E
M
 
V
A
 
L
T
 
A
K
 
R
E
 
E
R
 
K
R
 
R
G
 
G
F
 
E
Y
 
H
S
 
L
S
 
S
F
 
W

Sites not aligning to the query:

P14672 Solute carrier family 2, facilitated glucose transporter member 4; Glucose transporter type 4, insulin-responsive; GLUT-4 from Homo sapiens (Human) (see 6 papers)
25% identity, 41% coverage: 15:196/439 of query aligns to 15:195/509 of P14672

query
sites
P14672
P
 
P
A
 
P
K
 
Q
A
 
Q
R
 
R
T
 
V
T
 
T
S
 
G
S
 
T
R
 
L
I
 
V
K
 
L
S
 
A
I
 
V
F
 
F
S
 
S
G
 
A
S
 
V
V
 
L
G
 
G
N
 
S
M
 
L
V
 
Q
E
 
F
W
 
G
Y
 
Y
D
 
N
W
 
I
Y
 
G
V
 
V
Y
 
I
A
 
N
A
 
A
F
 
P
S
 
Q
L
 
K
Y
 
V
F
 
I
A
 
E
K
 
Q
A
 
S
F
 
Y
-
x
N
-
 
E
-
 
T
-
 
W
-
 
L
-
 
G
-
 
R
-
 
Q
-
 
G
-
 
P
-
 
E
-
 
G
-
 
P
-
 
S
-
 
S
F
 
I
P
 
P
K
 
P
G
 
G
D
 
T
T
 
L
T
 
T
A
 
T
Q
 
L
L
 
W
L
 
A
N
 
L
T
 
S
A
 
V
A
 
A
I
 
I
F
 
F
A
 
S
V
 
V
G
 
G
F
 
G
L
 
M
M
 
-
R
 
-
P
 
-
I
 
I
G
 
S
G
 
S
W
 
F
L
 
L
M
 
I
G
 
G
L
 
I
Y
 
I
A
 
S
D
 
Q
K
 
W
V
 
L
G
 
G
R
 
R
K
 
K
K
 
R
A
 
A
L
 
M
M
 
L
A
 
V
S
 
N
V
 
N
Y
 
V
L
 
L
M
 
A
C
 
V
F
 
L
G
 
G
S
 
G
L
 
S
L
 
L
I
 
M
A
 
G
L
 
L
S
 
A
P
 
N
G
 
A
-
 
A
-
 
A
-
 
S
Y
 
Y
E
 
E
I
 
-
I
 
-
G
 
-
I
 
-
G
 
-
A
 
-
P
 
-
I
 
-
L
 
M
L
 
L
V
 
I
F
 
L
A
 
G
R
 
R
L
 
F
L
 
L
Q
 
I
G
 
G
L
 
A
S
 
Y
V
 
S
G
 
G
G
 
L
E
 
T
Y
 
S
G
 
G
T
 
L
S
 
V
A
 
P
T
 
M
Y
 
Y
L
 
V
S
 
G
E
 
E
M
 
I
A
 
A
T
 
P
K
 
T
E
 
H
R
 
L
R
 
R
G
 
G
F
 
A
Y
 
L
S
 
G
S
 
T
F
 
L
Q
 
N
Y
 
Q
V
 
L
T
 
A
L
 
I
I
 
V
S
 
I
G
 
G
Q
 
I
L
 
L
I
 
I
A
 
A
L
 
-
A
 
-
V
 
-
L
 
-
I
 
-
V
 
-
L
 
-
Q
 
-
Q
 
Q
V
 
V
L
 
L
T
 
G
T
 
L
E
 
E
Q
 
S
L
 
L

Sites not aligning to the query:

Q02563 Synaptic vesicle glycoprotein 2A; Synaptic vesicle protein 2; Synaptic vesicle protein 2A from Rattus norvegicus (Rat) (see 2 papers)
24% identity, 39% coverage: 82:252/439 of query aligns to 217:394/742 of Q02563

query
sites
Q02563
I
 
V
G
 
G
G
 
A
W
 
F
L
 
L
M
 
W
G
 
G
L
 
G
Y
 
L
A
 
A
D
 
D
K
 
R
V
 
L
G
 
G
R
 
R
K
 
R
K
 
Q
A
 
C
L
 
L
M
 
L
A
 
I
S
 
S
V
 
L
Y
 
S
L
 
V
M
 
N
C
 
S
F
 
V
G
 
F
S
 
A
L
 
F
L
 
F
I
 
S
A
 
S
L
 
F
S
 
V
P
 
Q
G
 
G
Y
 
Y
E
 
G
I
 
T
I
 
-
G
 
-
I
 
-
G
 
-
A
 
-
P
 
-
I
 
-
L
 
-
L
 
F
V
 
L
F
 
F
A
 
C
R
 
R
L
 
L
L
 
L
Q
 
S
G
 
G
L
 
V
S
 
G
V
 
I
G
 
G
G
 
G
E
 
S
Y
 
I
G
 
P
T
 
I
S
 
V
A
 
F
T
 
S
Y
 
Y
L
 
F
S
 
S
E
 
E
M
 
F
A
 
L
T
 
A
K
 
Q
E
 
E
R
 
K
R
 
R
G
 
G
F
 
E
Y
 
H
S
 
L
S
 
S
F
 
W
Q
 
L
Y
 
C
V
 
M
T
 
F
L
 
W
I
 
M
S
 
I
G
 
G
Q
 
G
L
 
V
I
 
Y
A
 
A
L
 
A
A
 
A
V
 
M
L
 
A
I
 
W
V
 
A
L
 
I
Q
 
I
-
 
P
-
 
H
-
 
Y
-
 
G
-
 
W
-
x
S
-
x
F
Q
|
Q
V
x
M
L
x
G
T
x
S
T
x
A
E
x
Y
Q
|
Q
L
x
F
Y
x
H
A
 
S
W
 
W
-
 
R
-
 
V
-
 
F
-
 
V
-
 
L
-
 
V
-
 
C
G
 
A
W
 
F
R
 
P
I
 
S
P
 
V
F
 
F
A
 
A
I
 
I
G
 
G
A
 
A
L
 
L
C
 
T
A
 
T
V
 
Q
V
 
P
A
 
E
-
 
S
-
 
P
-
 
R
L
 
F
Y
 
F
L
 
L
R
 
E
R
 
N
G
 
G
M
 
K
E
 
H
E
 
D
T
 
-
E
 
E
S
 
A
F
 
W
T
 
M
K
 
V
K
 
L
E
 
K
K
 
Q
A
 
V
K
 
H
E
 
D
S
 
T
A
 
N
M
 
M
R
 
R
T
 
A
L
 
-
M
 
K
R
 
G
H
 
H
P
 
P
K
 
E
E
 
R
L
 
V
L
 
F
T
 
S
V
 
V

Sites not aligning to the query:

P11168 Solute carrier family 2, facilitated glucose transporter member 2; Glucose transporter type 2, liver; GLUT-2 from Homo sapiens (Human) (see 6 papers)
28% identity, 38% coverage: 73:240/439 of query aligns to 104:262/524 of P11168

query
sites
P11168
F
 
F
A
 
A
V
 
V
G
 
G
F
 
G
L
 
M
M
x
T
R
 
A
P
 
S
I
 
F
-
 
F
G
 
G
G
 
G
W
 
W
L
 
L
M
 
-
G
 
-
L
 
-
Y
 
-
A
 
G
D
 
D
K
 
T
V
 
L
G
 
G
R
 
R
K
 
I
K
 
K
A
 
A
L
 
M
M
 
L
A
 
V
S
 
A
V
 
N
Y
 
I
L
 
L
M
 
S
C
 
L
F
 
V
G
 
G
S
 
A
L
 
L
L
 
L
I
 
M
A
 
-
L
 
-
S
 
-
P
 
-
G
 
G
Y
 
F
E
 
S
I
 
K
I
 
L
G
 
G
I
 
-
G
 
P
A
 
S
P
 
H
I
 
I
L
 
L
L
 
I
V
 
I
F
 
A
A
 
G
R
 
R
L
 
S
L
 
I
Q
 
S
G
 
G
L
 
L
S
 
Y
V
 
C
G
 
G
G
 
L
E
 
I
Y
 
S
G
 
G
T
 
L
S
 
V
A
 
P
T
 
M
Y
 
Y
L
 
I
S
 
G
E
 
E
M
 
I
A
 
A
T
 
P
K
 
T
E
 
A
R
 
L
R
 
R
G
 
G
F
 
A
Y
 
L
S
 
G
S
 
T
F
 
F
Q
 
H
Y
 
Q
V
 
L
T
 
A
L
 
I
I
x
V
S
 
T
G
 
G
Q
 
I
L
 
L
I
 
I
A
 
S
L
 
Q
A
 
-
V
 
-
L
 
I
I
 
I
V
 
G
L
 
L
Q
 
E
Q
 
F
V
 
I
L
 
L
T
 
G
T
 
N
E
 
Y
Q
 
D
L
 
L
Y
 
-
A
 
-
W
 
-
G
 
-
W
 
W
R
 
H
I
 
I
P
 
L
F
 
L
A
 
G
I
 
L
G
 
S
A
 
G
L
 
V
C
 
R
A
 
A
V
 
I
V
 
L
A
 
Q
L
 
S
Y
 
L
L
 
L
R
 
L
R
 
F
G
 
F
M
 
C
E
 
P
E
 
E
T
 
S
E
 
P
S
 
R
F
 
Y
-
 
L
-
 
Y
-
 
I
-
 
K
-
 
L
T
 
D
K
 
E
K
 
E
E
 
V
K
 
K
A
 
A
K
 
K
E
 
Q
S
 
S
A
 
L
M
 
K
R
 
R

Sites not aligning to the query:

Query Sequence

>GFF4424 FitnessBrowser__WCS417:GFF4424
MDNSNSLPLGSAAAPAKARTTSSRIKSIFSGSVGNMVEWYDWYVYAAFSLYFAKAFFPKG
DTTAQLLNTAAIFAVGFLMRPIGGWLMGLYADKVGRKKALMASVYLMCFGSLLIALSPGY
EIIGIGAPILLVFARLLQGLSVGGEYGTSATYLSEMATKERRGFYSSFQYVTLISGQLIA
LAVLIVLQQVLTTEQLYAWGWRIPFAIGALCAVVALYLRRGMEETESFTKKEKAKESAMR
TLMRHPKELLTVVGLTMGGTLAFYTYTTYMQKYLVNTVGMSISDSTTISAATLFLFMCLQ
PIVGGLSDKVGRRPILIAFGILGTLFTVPILTTLHTIQSWWGAFFLIMAALIIVSGYTSI
NAVVKAELFPTEIRALGVGLPYALTVSIFGGTAEYIALWFKSIGMETGYYWYVTACIAVS
LAVYVTMKDTRKHSRITTD

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory