SitesBLAST
Comparing GFF4424 FitnessBrowser__WCS417:GFF4424 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
29% identity, 36% coverage: 88:244/439 of query aligns to 63:202/446 of A0A0H2VG78
- R102 (= R135) mutation to A: Loss of transport activity.
- I105 (≠ Q138) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E155) mutation to A: Loss of transport activity.
- Q137 (≠ Y170) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
- 250 Q→A: Loss of transport activity.
- 251 Q→A: Loss of transport activity.
- 256 N→A: Loss of transport activity.
- 357 W→A: Loss of transport activity.
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
29% identity, 35% coverage: 82:235/439 of query aligns to 98:258/583 of Q9Y7Q9
Sites not aligning to the query:
- 267 modified: Phosphoserine
- 269 modified: Phosphoserine
- 289 modified: Phosphoserine
- 290 modified: Phosphoserine
- 292 modified: Phosphoserine
- 330 modified: Phosphoserine
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
24% identity, 70% coverage: 78:384/439 of query aligns to 186:499/616 of P36035
- K338 (≠ R244) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 9 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Q6PXP3 Solute carrier family 2, facilitated glucose transporter member 7; Glucose transporter type 7; GLUT-7; hGLUT7 from Homo sapiens (Human) (see paper)
20% identity, 77% coverage: 92:431/439 of query aligns to 100:470/512 of Q6PXP3
- I302 (≠ T267) mutation to S: Does not affect glucose or fructose transport.; mutation to V: Abolished fructose transport.
O42885 Putative inorganic phosphate transporter C8E4.01c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 54% coverage: 3:238/439 of query aligns to 18:270/572 of O42885
Sites not aligning to the query:
- 12 modified: Phosphoserine
- 14 modified: Phosphoserine
- 292 modified: Phosphoserine
- 296 modified: Phosphoserine
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 35% coverage: 92:244/439 of query aligns to 93:230/580 of Q9C757
Sites not aligning to the query:
- 399 C→A: Strongly decreased nickel inhibition; when associated with A-402, A-410 and A-413.; C→S: No effect on inostol transport or nickel inhibition. No effect on inostol transport or nickel inhibition; when associated with S-410.
- 402 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-410 and A-413.
- 410 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-413.; C→S: No effect on inostol transport or nickel inhibition; when associated with S-399.
- 413 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-410.
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
26% identity, 35% coverage: 82:235/439 of query aligns to 117:283/587 of P25297
Sites not aligning to the query:
- 6 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
- 298 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
23% identity, 49% coverage: 21:233/439 of query aligns to 37:230/444 of Q8NLB7
- D54 (≠ E38) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- D57 (= D41) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (≠ K93) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 309 W→V: Loss of transport activity.
- 312 D→A: Loss of transport activity.
- 313 R→A: Loss of transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
28% identity, 25% coverage: 58:168/439 of query aligns to 177:281/727 of Q496J9
Sites not aligning to the query:
- 519:563 (Microbial infection) C.botulinum neurotoxin type A-binding
- 534 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 559 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: No change in interaction with C.botulinum neurotoxin type A heavy chain (botA, BoNT/A HC). Decreased molecular weight probably due to glycosylation loss, decreased interaction with BoNT/A HC.; N→Q: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC. Greater reduction in weight; when associated with Q-565.
- 561 S→A: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC.
- 563 F→A: No longer interacts with BoNT/A HC.
- 565 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Decreased molecular weight probably due to glycosylation loss, no change in binding to BoNT/A heavy chain. Greater reduction in weight; when associated with Q-559.
P14142 Solute carrier family 2, facilitated glucose transporter member 4; GT2; Glucose transporter type 4, insulin-responsive; GLUT-4 from Mus musculus (Mouse) (see paper)
25% identity, 38% coverage: 15:180/439 of query aligns to 15:187/509 of P14142
- N57 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
27% identity, 25% coverage: 58:168/439 of query aligns to 177:281/727 of Q9Z2I6
Sites not aligning to the query:
- 1:57 Interaction with SYT1
- 529:566 (Microbial infection) C.botulinum neurotoxin type A-binding
- 559 N→A: Loss of one glycosylation site. No effect on C.botulinum neurotoxin type A (BoNT/A, botA) binding, but reduces the uptake of BoNT/A.
8fvzA Pipt y150a
25% identity, 45% coverage: 24:219/439 of query aligns to 2:200/433 of 8fvzA
Sites not aligning to the query:
P14672 Solute carrier family 2, facilitated glucose transporter member 4; Glucose transporter type 4, insulin-responsive; GLUT-4 from Homo sapiens (Human) (see 6 papers)
25% identity, 41% coverage: 15:196/439 of query aligns to 15:195/509 of P14672
- N57 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Sites not aligning to the query:
- 7:13 Interaction with SRFBP1
- 223 C→S: Loss of palmitoylation.
- 274 modified: Phosphoserine; by SGK1
- 385 I → T: in dbSNP:rs775242206
- 489:490 Dileucine internalization motif; LL→AA: Changes subcellular location mainly to the plasma membrane.
Q02563 Synaptic vesicle glycoprotein 2A; Synaptic vesicle protein 2; Synaptic vesicle protein 2A from Rattus norvegicus (Rat) (see 2 papers)
24% identity, 39% coverage: 82:252/439 of query aligns to 217:394/742 of Q02563
- 321:331 (vs. 189:197, 18% identical) mutation Missing: No change in uptake of BoNT/D or BoNT/E.
Sites not aligning to the query:
- 196:200 mutation Missing: No change in uptake of C.botulinum neurotoxin type D (BoNT/D, botD) or C.botulinum neurotoxin type E (BoNT/E).
- 498 N→Q: No change in uptake of BoNT/E or C.botulinum neurotoxin type A (BoNT/A, botA) by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-548. No change in uptake of BoNT/D.
- 548 N→Q: No change in uptake of BoNT/E or BoNT/A by mouse SV2A/SV2B knockout neurons; SV2A apparent molecular weight decreases. No change in uptake of BoNT/E; when associated with Q-498. No change in uptake of BoNT/D.
- 570:573 RLVN→TLVQ: Restores apparent molecular weight to wild-type, does not restore uptake of BoNT/E.
- 573 N→Q: BoNT/E not taken up by mouse SV2A/SV2B knockout neurons, decreased uptake of BoNT/A; SV2A apparent molecular weight decreases. No change in uptake of BoNT/D.
P11168 Solute carrier family 2, facilitated glucose transporter member 2; Glucose transporter type 2, liver; GLUT-2 from Homo sapiens (Human) (see 6 papers)
28% identity, 38% coverage: 73:240/439 of query aligns to 104:262/524 of P11168
- T110 (≠ M79) to I: in dbSNP:rs5400
- V197 (≠ I174) to I: in NIDDM; abolishes transport activity of the transporter expressed in Xenopus oocytes; dbSNP:rs121909741
Sites not aligning to the query:
- 68 P → L: in dbSNP:rs7637863
- 322 I→V: Reduced fructose transport.
Query Sequence
>GFF4424 FitnessBrowser__WCS417:GFF4424
MDNSNSLPLGSAAAPAKARTTSSRIKSIFSGSVGNMVEWYDWYVYAAFSLYFAKAFFPKG
DTTAQLLNTAAIFAVGFLMRPIGGWLMGLYADKVGRKKALMASVYLMCFGSLLIALSPGY
EIIGIGAPILLVFARLLQGLSVGGEYGTSATYLSEMATKERRGFYSSFQYVTLISGQLIA
LAVLIVLQQVLTTEQLYAWGWRIPFAIGALCAVVALYLRRGMEETESFTKKEKAKESAMR
TLMRHPKELLTVVGLTMGGTLAFYTYTTYMQKYLVNTVGMSISDSTTISAATLFLFMCLQ
PIVGGLSDKVGRRPILIAFGILGTLFTVPILTTLHTIQSWWGAFFLIMAALIIVSGYTSI
NAVVKAELFPTEIRALGVGLPYALTVSIFGGTAEYIALWFKSIGMETGYYWYVTACIAVS
LAVYVTMKDTRKHSRITTD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory