Comparing GFF446 FitnessBrowser__Phaeo:GFF446 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
36% identity, 98% coverage: 1:258/262 of query aligns to 1:261/261 of 2xuaH
4uhfA Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound) (see paper)
30% identity, 97% coverage: 7:261/262 of query aligns to 13:276/278 of 4uhfA
4uheA Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound) (see paper)
30% identity, 92% coverage: 7:246/262 of query aligns to 13:257/272 of 4uheA
4uhdA Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) (see paper)
30% identity, 92% coverage: 7:246/262 of query aligns to 13:257/274 of 4uhdA
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
30% identity, 99% coverage: 1:259/262 of query aligns to 1:263/265 of 6eb3A
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
30% identity, 99% coverage: 1:259/262 of query aligns to 1:266/268 of 6eb3B
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
30% identity, 99% coverage: 1:260/262 of query aligns to 1:261/262 of 6eb3C
5h3hB Esterase (eaest) from exiguobacterium antarcticum (see paper)
25% identity, 90% coverage: 21:256/262 of query aligns to 21:266/269 of 5h3hB
5z7xA Crystal structure of striga hermonthica htl4 (shhtl4) (see paper)
26% identity, 85% coverage: 24:247/262 of query aligns to 21:256/270 of 5z7xA
5cbkA Crystal structure of the strigolactone receptor shhtl5 from striga hermonthica (see paper)
24% identity, 90% coverage: 24:258/262 of query aligns to 20:266/271 of 5cbkA
Sites not aligning to the query:
8dvcA Receptor shhtl5 from striga hermonthica in complex with strigolactone agonist gr24 (see paper)
24% identity, 90% coverage: 24:258/262 of query aligns to 18:264/268 of 8dvcA
7k38A Crystal structure of pisum sativum kai2 in complex with gr24-ent5ds product (see paper)
24% identity, 85% coverage: 24:247/262 of query aligns to 20:255/270 of 7k38A
4lyeA Crystal structure of the s105a mutant of a c-c hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with substrate hopda (see paper)
24% identity, 97% coverage: 3:256/262 of query aligns to 9:273/276 of 4lyeA
4lxiA Crystal structure of the s105a mutant of a carbon-carbon bond hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with 5, 8-dif hopda (see paper)
24% identity, 97% coverage: 3:256/262 of query aligns to 9:273/276 of 4lxiA
4lxhA Crystal structure of the s105a mutant of a carbon-carbon bond hydrolase, dxnb2 from sphingomonas wittichii rw1, in complex with 3- cl hopda (see paper)
24% identity, 97% coverage: 3:256/262 of query aligns to 9:273/276 of 4lxhA
4ihaA Crystal structure of rice dwarf14 (d14) in complex with a gr24 hydrolysis intermediate (see paper)
23% identity, 87% coverage: 24:252/262 of query aligns to 22:261/268 of 4ihaA
5zhsA Crystal structure of osd14 in complex with covalently bound kk052 (see paper)
23% identity, 87% coverage: 24:252/262 of query aligns to 18:257/264 of 5zhsA
6ap8A Crystal structure of rice d14 bound to 2-(2-methyl-3-nitroanilino) benzoic acid (see paper)
23% identity, 87% coverage: 24:252/262 of query aligns to 20:259/266 of 6ap8A
5dj5A Crystal structure of rice dwarf14 in complex with synthetic strigolactone gr24 (see paper)
23% identity, 87% coverage: 24:252/262 of query aligns to 20:259/266 of 5dj5A
6brtA F-box protein cth with hydrolase (see paper)
23% identity, 87% coverage: 24:252/262 of query aligns to 39:278/285 of 6brtA
>GFF446 FitnessBrowser__Phaeo:GFF446
MPFVDLGDVQLHYQLDGTADGPPLVFANSLGTDLHVWDLVVERLPKELRIIRYDLRGHGG
TPATPAPYSMGTLVRDAERLLDQLQVKGCIFVGLSIGGMIAQGLAIKRLDLMRGLVLSNT
AAKIGTAAAWQQRIEAIKRDGIDAVADTIMERWFAPAFRKSPELSHWRAHLLQQSVEGYI
GCCAAISGTDFYTPTSGLRLPTLGIAGSDDGATPADLVRETVDLIPGSKFELIRRAGHIP
CVEQPEVFADRLITFLTEQGHI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory