SitesBLAST
Comparing GFF448 FitnessBrowser__Phaeo:GFF448 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
42% identity, 99% coverage: 1:320/324 of query aligns to 3:317/319 of A4F2N8
- K53 (= K51) mutation to A: Loss of enzymatic activity.
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
38% identity, 99% coverage: 1:322/324 of query aligns to 3:319/319 of 2zr8A
- active site: K53 (= K51), S78 (= S76), E204 (= E206), G208 (≠ F210), D210 (= D212), G232 (≠ A235), I303 (≠ A306), S304 (≠ T307)
- binding magnesium ion: E204 (= E206), G208 (≠ F210), D210 (= D212)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F50), K53 (= K51), S77 (= S75), S78 (= S76), N80 (= N78), H81 (= H79), P147 (= P145), G179 (= G181), G180 (= G182), G181 (= G183), G182 (= G184), G232 (≠ A235), E277 (= E280), T279 (≠ G282), S304 (≠ T307)
- binding serine: S78 (= S76), R129 (= R127), D231 (= D234), G232 (≠ A235), A233 (≠ I236), Q234 (≠ L237), T235 (= T238)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
38% identity, 99% coverage: 1:322/324 of query aligns to 3:319/319 of 2zpuA
- active site: K53 (= K51), S78 (= S76), E204 (= E206), G208 (≠ F210), D210 (= D212), G232 (≠ A235), I303 (≠ A306), S304 (≠ T307)
- binding magnesium ion: E204 (= E206), G208 (≠ F210), D210 (= D212)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F50), K53 (= K51), S77 (= S75), S78 (= S76), N80 (= N78), H81 (= H79), P147 (= P145), G179 (= G181), G180 (= G182), G181 (= G183), G182 (= G184), G232 (≠ A235), E277 (= E280), T279 (≠ G282), S304 (≠ T307)
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
38% identity, 99% coverage: 1:322/324 of query aligns to 7:323/323 of O59791
- S82 (= S76) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
38% identity, 99% coverage: 1:320/324 of query aligns to 2:316/318 of 1wtcA
- active site: K52 (= K51), S77 (= S76), E203 (= E206), G207 (≠ F210), D209 (= D212), G231 (≠ A235), I302 (≠ A306), S303 (≠ T307)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ R19), K47 (≠ H46), M48 (≠ T47), A109 (= A108), A110 (≠ N109), Y114 (≠ L113)
- binding magnesium ion: E203 (= E206), G207 (≠ F210), D209 (= D212)
- binding pyridoxal-5'-phosphate: F51 (= F50), K52 (= K51), N79 (= N78), G178 (= G181), G179 (= G182), G180 (= G183), G181 (= G184), G231 (≠ A235), E276 (= E280), T278 (≠ G282), S303 (≠ T307)
1v71A Crystal structure of s.Pombe serine racemase
38% identity, 99% coverage: 1:320/324 of query aligns to 2:316/318 of 1v71A
- active site: K52 (= K51), S77 (= S76), E203 (= E206), G207 (≠ F210), D209 (= D212), G231 (≠ A235), I302 (≠ A306), S303 (≠ T307)
- binding magnesium ion: E203 (= E206), G207 (≠ F210), D209 (= D212)
- binding pyridoxal-5'-phosphate: F51 (= F50), K52 (= K51), N79 (= N78), G178 (= G181), G179 (= G182), G180 (= G183), G181 (= G184), G231 (≠ A235), E276 (= E280), T278 (≠ G282), S303 (≠ T307), G304 (= G308)
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
35% identity, 98% coverage: 6:322/324 of query aligns to 23:338/339 of Q7XSN8
- E219 (= E206) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (= D212) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
5cvcA Structure of maize serine racemase (see paper)
35% identity, 98% coverage: 6:322/324 of query aligns to 7:322/329 of 5cvcA
- active site: K52 (= K51), S77 (= S76), E203 (= E206), A207 (≠ F210), D209 (= D212), G231 (≠ A235), V306 (≠ A306), S307 (≠ T307)
- binding magnesium ion: E203 (= E206), A207 (≠ F210), D209 (= D212)
- binding pyridoxal-5'-phosphate: F51 (= F50), K52 (= K51), N79 (= N78), S178 (≠ G181), G179 (= G182), G180 (= G183), G181 (= G184), L232 (= L237), E275 (= E280), S307 (≠ T307), G308 (= G308)
1ve5A Crystal structure of t.Th. Hb8 threonine deaminase
45% identity, 96% coverage: 3:312/324 of query aligns to 2:305/308 of 1ve5A
- active site: K50 (= K51), S56 (≠ A57), S72 (= S76), E200 (= E206), A204 (≠ F210), D206 (= D212), G229 (≠ A235), L299 (≠ A306), S300 (≠ T307)
- binding calcium ion: E200 (= E206), A204 (≠ F210), D206 (= D212)
- binding pyridoxal-5'-phosphate: F49 (= F50), K50 (= K51), N74 (= N78), G175 (= G181), G176 (= G182), G177 (= G183), G178 (= G184), E274 (= E280), T276 (≠ G282), S300 (≠ T307), G301 (= G308)
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
33% identity, 96% coverage: 3:312/324 of query aligns to 5:315/320 of 7nbhAAA
- active site: K53 (= K51), S81 (= S76), E207 (= E206), A211 (≠ F210), D213 (= D212), G236 (≠ A235), L309 (vs. gap), S310 (≠ T307)
- binding calcium ion: E207 (= E206), A211 (≠ F210), D213 (= D212)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (= S76), G85 (≠ A80), Q86 (= Q81), K111 (= K106), I115 (≠ T110), Y118 (≠ L113), D235 (= D234), P281 (= P281), N313 (= N310), V314 (= V311), D315 (= D312)
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
33% identity, 96% coverage: 3:312/324 of query aligns to 5:315/322 of 7nbgAAA
- active site: K53 (= K51), S81 (= S76), E207 (= E206), A211 (≠ F210), D213 (= D212), G236 (≠ A235), L309 (vs. gap), S310 (≠ T307)
- binding calcium ion: E207 (= E206), A211 (≠ F210), D213 (= D212)
- binding pyridoxal-5'-phosphate: F52 (= F50), K53 (= K51), N83 (= N78), G182 (= G181), G183 (= G182), G184 (= G183), G185 (= G184), M186 (≠ L185), G236 (≠ A235), V237 (≠ I236), T282 (≠ G282), S310 (≠ T307), G311 (= G308)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (= S76), G85 (≠ A80), Q86 (= Q81), I101 (= I96), K111 (= K106), I115 (≠ T110), Y118 (≠ L113)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
33% identity, 96% coverage: 3:312/324 of query aligns to 5:315/323 of 7nbfAAA
- active site: K53 (= K51), S81 (= S76), E207 (= E206), A211 (≠ F210), D213 (= D212), G236 (≠ A235), L309 (vs. gap), S310 (≠ T307)
- binding calcium ion: E207 (= E206), A211 (≠ F210), D213 (= D212)
- binding magnesium ion: N244 (≠ I244)
- binding pyridoxal-5'-phosphate: F52 (= F50), K53 (= K51), N83 (= N78), G182 (= G181), G183 (= G182), G184 (= G183), G185 (= G184), M186 (≠ L185), G236 (≠ A235), V237 (≠ I236), T282 (≠ G282), S310 (≠ T307), G311 (= G308)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: H21 (≠ R19), L22 (≠ E20), T23 (= T21), P24 (= P22), L26 (= L24), T27 (≠ S25), F46 (≠ L44)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
33% identity, 96% coverage: 3:312/324 of query aligns to 5:315/323 of 7nbdAAA
- active site: K53 (= K51), S81 (= S76), E207 (= E206), A211 (≠ F210), D213 (= D212), G236 (≠ A235), L309 (vs. gap), S310 (≠ T307)
- binding calcium ion: E207 (= E206), A211 (≠ F210), D213 (= D212)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ F272), L278 (≠ V278), V314 (= V311)
- binding magnesium ion: N244 (≠ I244)
- binding pyridoxal-5'-phosphate: F52 (= F50), K53 (= K51), N83 (= N78), G182 (= G181), G183 (= G182), G184 (= G183), G185 (= G184), M186 (≠ L185), G236 (≠ A235), V237 (≠ I236), E280 (= E280), T282 (≠ G282), S310 (≠ T307), G311 (= G308)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
33% identity, 96% coverage: 3:312/324 of query aligns to 5:315/323 of 7nbcCCC
- active site: K53 (= K51), S81 (= S76), E207 (= E206), A211 (≠ F210), D213 (= D212), G236 (≠ A235), L309 (vs. gap), S310 (≠ T307)
- binding biphenyl-4-ylacetic acid: T78 (≠ A73), H79 (≠ Y74), H84 (= H79), V148 (≠ I143), H149 (≠ K144), P150 (= P145)
- binding calcium ion: E207 (= E206), A211 (≠ F210), D213 (= D212)
- binding pyridoxal-5'-phosphate: F52 (= F50), K53 (= K51), N83 (= N78), G182 (= G181), G183 (= G182), G184 (= G183), G185 (= G184), M186 (≠ L185), G236 (≠ A235), V237 (≠ I236), T282 (≠ G282), S310 (≠ T307), G311 (= G308)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
33% identity, 96% coverage: 3:312/324 of query aligns to 5:315/323 of 7nbcAAA
- active site: K53 (= K51), S81 (= S76), E207 (= E206), A211 (≠ F210), D213 (= D212), G236 (≠ A235), L309 (vs. gap), S310 (≠ T307)
- binding calcium ion: E207 (= E206), A211 (≠ F210), D213 (= D212)
- binding magnesium ion: N244 (≠ I244)
- binding pyridoxal-5'-phosphate: F52 (= F50), K53 (= K51), N83 (= N78), G182 (= G181), G183 (= G182), G184 (= G183), G185 (= G184), M186 (≠ L185), G236 (≠ A235), V237 (≠ I236), T282 (≠ G282), S310 (≠ T307), G311 (= G308)
Sites not aligning to the query:
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
33% identity, 96% coverage: 3:312/324 of query aligns to 5:310/310 of 7nbgDDD
- active site: K53 (= K51), S76 (= S76), E202 (= E206), A206 (≠ F210), D208 (= D212), G231 (≠ A235), L304 (vs. gap), S305 (≠ T307)
- binding calcium ion: E202 (= E206), A206 (≠ F210), D208 (= D212)
- binding magnesium ion: N239 (≠ I244)
- binding ortho-xylene: S76 (= S76), Q81 (= Q81), I96 (= I96), Y113 (≠ L113)
- binding pyridoxal-5'-phosphate: F52 (= F50), K53 (= K51), N78 (= N78), G177 (= G181), G178 (= G182), G179 (= G183), G180 (= G184), M181 (≠ L185), G231 (≠ A235), V232 (≠ I236), E275 (= E280), T277 (≠ G282), S305 (≠ T307), G306 (= G308)
Sites not aligning to the query:
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
33% identity, 96% coverage: 3:312/324 of query aligns to 6:311/322 of 3l6bA
- active site: K54 (= K51), S77 (= S76), E203 (= E206), A207 (≠ F210), D209 (= D212), G232 (≠ A235), T278 (≠ G282), L305 (vs. gap), S306 (≠ T307)
- binding malonate ion: K54 (= K51), S76 (= S75), S77 (= S76), N79 (= N78), H80 (= H79), R128 (= R127), G232 (≠ A235)
- binding manganese (ii) ion: E203 (= E206), A207 (≠ F210), D209 (= D212)
- binding pyridoxal-5'-phosphate: F53 (= F50), K54 (= K51), N79 (= N78), G178 (= G181), G179 (= G182), G180 (= G183), G181 (= G184), M182 (≠ L185), V233 (≠ I236), E276 (= E280), T278 (≠ G282), S306 (≠ T307), G307 (= G308)
6zspAAA serine racemase bound to atp and malonate. (see paper)
33% identity, 96% coverage: 3:312/324 of query aligns to 5:308/320 of 6zspAAA
- active site: K53 (= K51), S74 (= S76), E200 (= E206), A204 (≠ F210), D206 (= D212), G229 (≠ A235), L302 (vs. gap), S303 (≠ T307)
- binding adenosine-5'-triphosphate: S28 (= S26), S29 (≠ P27), I30 (≠ F28), K48 (≠ H46), T49 (= T47), Q79 (= Q81), Y111 (≠ L113), E266 (≠ L273), R267 (= R274), K269 (= K276), N306 (= N310)
- binding magnesium ion: E200 (= E206), A204 (≠ F210), D206 (= D212)
- binding malonate ion: K53 (= K51), S73 (= S75), S74 (= S76), N76 (= N78), H77 (= H79), R125 (= R127), G229 (≠ A235), S232 (≠ T238)
Q9QZX7 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Mus musculus (Mouse) (see paper)
34% identity, 96% coverage: 3:312/324 of query aligns to 8:318/339 of Q9QZX7
- C113 (≠ I105) modified: S-nitrosocysteine; mutation to S: Abolishes S-nitrosylation.
3hmkA Crystal structure of serine racemase (see paper)
34% identity, 96% coverage: 3:312/324 of query aligns to 6:316/321 of 3hmkA
- active site: K54 (= K51), S82 (= S76), E208 (= E206), A212 (≠ F210), D214 (= D212), G237 (≠ A235), T283 (≠ G282), L310 (vs. gap), S311 (≠ T307)
- binding manganese (ii) ion: E208 (= E206), A212 (≠ F210), D214 (= D212)
- binding pyridoxal-5'-phosphate: F53 (= F50), K54 (= K51), N84 (= N78), G183 (= G181), G184 (= G182), G185 (= G183), G186 (= G184), M187 (≠ L185), G237 (≠ A235), V238 (≠ I236), T283 (≠ G282), S311 (≠ T307), G312 (= G308)
Query Sequence
>GFF448 FitnessBrowser__Phaeo:GFF448
MTSFAAIAAAADRLSGHARETPLLSSPFLDEIAGRRVLIKAECLQHTGSFKFRGGWAALS
ALTDEQRHRGVLAYSSGNHAQGVAAAAAAHTTPAVILMPQDAPAIKIANTRALGAEVVLF
DRAKDNRDAIGAELAEARGLTLIKPYDDVEVVAGQGTVGLEIARQAADLDVTEADVLVCC
GGGGLTAGVALALEQTAPKMKVSPCEPERFDDVTRSLVAGKICRNEASAGSLCDAILTPA
PGEITFPILARLCGSGIVVSEEDAMRAMVLAFLRLKIVLEPGGAVSLAAALFHGDQLSGP
AAIAIATGGNVDAALFTEALHRFG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory